Conserved Protein Domain Family
yciY_fam

?
NF033701: yciY_fam 
YciY family protein
Members of the YciY family are named after the gene symbol given in E. coli K-12, but members of the family are found also in Salmonella, Klebsiella, Yersinia, Erwinia, etc.
Statistics
?
PSSM-Id: 411291
Aligned: 34 rows
Threshold Bit Score: 46.1636
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005126414  1 MKRSRTEVGRWRMLRQASRRKARWLEGQSRRNMRIHSIRKCILNHQRNSLLFAIYS 56  Citrobacter
WP_003853917  1 MKRSRNEVARWRMLRQVHRRRSRWLEGQSRRYKRIHCIRHQLAQQQRRSILFITQI 56  Pantoea
WP_006119368  1 MRRSRNEVARWRMLRQVQRRRSRWLEGQSRRYKRIHGIRHQLAQQQRRSILFITQN 56  Pantoea
WP_007892390  1 MRRSKNEVARWRMLRQVHRRRSRWLEGQSRRYKRIHTIRHQVAQQHRRSILFISQM 56  Enterobacterales
WP_012441330  1 MRRGTAEVARWRMIRQAQRRRARWLEGQSRRYGRMHGFRHQPGQQQRRSILFITQV 56  Erwinia tasmaniensis
WP_012769897  1 MKRSRNEVSRWRMQRQVQRRRSRWLEAQSRGYRHIHYVRYLREKQQRRALLYAVAY 56  Dickeya
WP_005968698  1 MKRSRNEVGRWRMLRQVQRRRSRWLEAQSRTYRHIRSARYLQQKHQRRALLYAVAY 56  Pectobacterium
WP_012765554  1 MKRSRNEVSRWRMLRQVQRRRARWLEAQSRSYRHIRHIRLLQEKLHRRSHLYAVVY 56  Musicola
WP_015697085  1 MKRSKNEVGRWRMLRQTQRRRSRWLEGQSRRYRHIYRIRQIHHQQHQRLSLYAVNY 56  Yersiniaceae
WP_002388651  1 MRRSRNEVGRWRMLRQNQRRKTRWLEGQSRRYRHIYCVRQLHEHQHRRALLFTVAY 56  Yersinia pseudotuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap