Conserved Protein Domain Family
suffix_2_RND

?
NF033684: suffix_2_RND 
transporter suffix domain
Members of this protein family contain a highly hydrophobic region about 70 amino acids long that usually occurs as essentially the full length of a small membrane protein, but in some cases occurs as a C-terminal suffix domain for RND efflux transporter permease subunit proteins.
Statistics
?
PSSM-Id: 411281
Aligned: 53 rows
Threshold Bit Score: 43.3312
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003041498   6 KYYLGILLFILSFVPYiLVFVIMPFLGLSTSSYLAVSSILLISAEAIFLVSVMLLGRAIIDAIKAAIKKV 75  Francisella tularensis
WP_011516485  17 RFRAGIGVFVLAYAVW-GLVPIAAFAGVSATGIATLTGGIVVVNKIMLLASIAVMGKPGFERLKALLLRR 85  Cupriavidus metallidurans
WP_008162223  17 RFKCGIGLFILAFALW-FLIPIAAAVDAPGSRIAALTGAIFIANKVLLITCIAVMGKEGFQQLKSIVFGH 85  Achromobacter arsenitoxydans
WP_013394944  17 RFKCGIGLFIIAFALW-FLIPVAGYMDVPGSRIAALTGTVFIANKVLLLSCIAVMGKEGFQRLKSIVFGH 85  Achromobacter xylosoxidans
WP_007957055  16 RFKVGVAIICLMLGSW-LMVPIAAALDVPGSKVAALTGVLFISNKVLLLLVIAVMGKAGFAELKRTIGHY 84  unclassified Pseudomonas
WP_007938196  16 RFKAGIAILSLTVISW-LAVPLAAAADVPGPKIAALTGILFISNKILLILAIAVMGKSGFQQLKSNVFGY 84  Pseudomonas sp. GM18
WP_020290495  15 RFKAGIAIICVMAGSW-LTVPVMAALDVPGSRIAALTGILFISNKVLLILVIAIMGKSGFQQLKRSVFGY 83  Pseudomonas sp. CFII64
WP_008026406  10 RFKLGIAIICLMLGSW-LLVPIMAATDMPGSKIAALTGVLFISNKVLLIIVIAVMGKAGFQQLKSTVFGY 78  Pseudomonas sp. GM60
WP_019689862  16 RFKVGIVIICLMLGSW-LMVPLAAVADVPGSKIAALTGVLFISNKILLILVIAVMGKSGFQQLKRSLFGY 84  Pseudomonas fluorescens
WP_007900294  16 RFKLGIAIICLMLGSW-LMVPLAAAVDVPGSKIAALTGVLFISNKVLLILVIAIMGKSGFQQLKRSMFGY 84  Pseudomonas sp. GM102
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap