Conserved Protein Domain Family
Lacb_SerRich_Nt

?
NF033676: Lacb_SerRich_Nt 
serine-rich glycoprotein adhesin prefix domain
Lacb_SerRich_Nt describes a Lactobacillus-restricted N-terminal non-repetitive sequence region shared by proteins with extensive serine-rich repeat regions, all likely to function as adhesins. This region contains a variant form of the KxYKxGKxW motif (see TIGR03715) followed by a region related to serine-rich glycoprotein adhesins of the Streptococci.
Statistics
?
PSSM-Id: 411273
Aligned: 13 rows
Threshold Bit Score: 94.3917
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_080967900    6 NRDYAEAKEASKVKLYKTHRGWMSCLSRFFSLMKFGKKEEISANQIKLEKGFDDDAlSGPLDSYAKGLAAFGAVL-GTTA 84   Lactobacillus...
KEK14305        5 KRKFDKEEDQSKVKMYKTHHGWVSCLTRFFHLLSFGSKEEVHAQTFVDPDEINDKM-SSTTEAYLKGLSAMTTLL-GVGG 82   Lactobacillus...
WP_003714933    6 RRKTDRELDDTRVKMYKTHHGWVSCLTRFFHLLSFGSKEEVQAEQFIDKDSIKEQR-AMSTDAYLKGLGLLSTLL-GVGG 83   Limosilactoba...
EGS39468        5 NRKIDREEDRSQVKLYKTRHGWVSCLTRFFHLLSFGAKSEVRAEQFVNPDDLKDHV-SGSTESYLKGMSVLGATMlGIGG 83   Limosilactoba...
WP_048344855    6 VRKISKVDETERIKLYKTHRGWCSSLSHFWTFLK--------------ADSIDEDD-ETSYEDYLKAIATIGTIA-GATM 69   Limosilactoba...
WP_085649804    2 AKNNKEQEDKSKVKLYKTKHGWFSALTRFFKLFSFSSKKEVKATDFNDLDSLKNMHtSDTADVYKKGAATMATLL-GAGV 80   Lactobacillus...
WP_063164570    2 AINNKEQEDKSKVKLYKTKHGWFSALTRFFKIFAFRSKREVKTTDFNDLDSLKNIHnSDTADAYKKGAATVATLL-GIGA 80   Limosilactoba...
OYS80430        2 AKNNKEQEDKSKVKLYKTKHGWFSALTRFFKMFSFRTKKEVKPTNFQDLDSLKNANvSDSRDAYKKGAATVATLL-GIGA 80   Limosilactoba...
KEK16917        2 TRHNKEQEDKSKVKLYKTKHGWFSALTRFFKIFAFRSKKEVKPTNFNDLDSLKDNQ-SDPTDAYKKGAAIVATLF-GVGA 79   Limosilactoba...
WP_086132055    2 SKRKNEQENGSKVKLYKTKHGWFSALTRFFKLFSFRSKKEVKPTNFNDLDSLKDKHdSAMPDAYKKGAATMATLL-GAGV 80   Limosilactoba...
WP_086141363    2 VKHKQAQETKSKVKLYKTKRGWFSALTRFFGLFSFMSKKEVHPIDLNDLDALKDAD---TSDNYKKGIATVATLF-GMGA 77   Limosilactoba...
WP_019252808    2 TKFSHSHEERSKVKLYKTKRGWFSAITHFFQCFSFQTNRGK-----DETDALIADRtTNNVGVYKNGGVIVATLL-GASA 75   Limosilactoba...
WP_102281375    5 EHSRGEQHDKDRIKLYKTHRGWMTSLTR---IFRFVFRDRSSKEEFTDRDALKEDDdDTGISPFVQGLTAIAALF-GGGA 80   [Lactobacillu...
WP_080967900   85 L 85   Lactobacillus mucosae
KEK14305       83 V 83   Lactobacillus reuteri
WP_003714933   84 V 84   Limosilactobacillus oris
EGS39468       84 A 84   Limosilactobacillus oris F0423
WP_048344855   70 L 70   Limosilactobacillus mucosae
WP_085649804   81 I 81   Lactobacillus reuteri
WP_063164570   81 T 81   Limosilactobacillus reuteri
OYS80430       81 T 81   Limosilactobacillus reuteri
KEK16917       80 A 80   Limosilactobacillus reuteri
WP_086132055   81 I 81   Limosilactobacillus reuteri
WP_086141363   78 I 78   Limosilactobacillus reuteri
WP_019252808   76 I 76   Limosilactobacillus reuteri
WP_102281375   81 A 81   [Lactobacillus] timonensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap