Conserved Protein Domain Family
rSAM_PA0069

?
NF033668: rSAM_PA0069 
PA0069 family radical SAM protein
PA0069 from Pseudomonas aeruginosa is the founding member a family of radical SAM enzymes of unknown function. Note that inclusion of some members of this family in COG1533, along with some spore photoproduct lyase (SPL) proteins, has led to some family members being annotated as SPL.
Statistics
?
PSSM-Id: 468133
Aligned: 30 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005411746  13 KGRGSASRVPSRFDATTTVGVDDG-WesiyEDLQE--L-PRLRTEVTEERARTVISRNNSPDVGFGASVNPYRGCEHGCV 88  Stenotrophomona...
WP_019942207   6 RGRGAAINTRNKFFKHEIEYTSED-W----QQWED--PeVNPKTQFIEEESKTLMSVSDSPDLPDFHSINPYRGCEHGCI 78  Dyadobacter bei...
WP_010602357  10 RGRGAQVNPHNKFLKDIYVKEYDEgI----DDWEE----SDHKTSFIFENSKSIVNKVDSPDVGMAYSLNPYQGCEHGCS 81  Pedobacter agri
WP_008242883  14 KGRGAQLNPNNRFFKNEYVKEHEEgI----DDWED----PEQKTSFIFGQSKSIVNKVTSPDVGMAYSLNPYQGCEHGCT 85  Pedobacter sp. ...
WP_017731022   8 KGRGSQIQTANPFLQQQYVSEHIE------GLDEP--LlSQPQTQIFKESPKKIVSKVDSPDLGKVYSVNPYQGCEHGCV 79  Nafulsella turp...
WP_014032760   8 KGRGAQKNTSNRFLQHVYEMREDF-LefcrLEGEE--A-ESNKTKYIPIFPKTIVNKVDSPDVGMGYSMNPYQGCEHGCI 83  Muricauda ruest...
WP_010585980  60 VGRGAQSNPTNRFARIEVVVDEDS-Fd---ESSEE--NpPRTKTQYFSDLSKSVVTENDSPDVFFRYSINPYRGCSHGCS 133 Schlesneria pal...
WP_002645053   1 MRHGSNLDPPNRFESTHVEPDLEQ------LEWNDeyLsQPRRIEYIDDNSKSIVTENDSPDLNFRYSVNPYRGCAHGCS 74  Gimesia maris
WP_013627236   2 VRHGSQIDPPNRFEKVHVVPDWEQ-LewdvEYQQE--R-ADRPVQYLADASRSIVSENDSPDVPFRYSINPYRGCAHACP 77  Rubinisphaera b...
WP_014197736  10 KGRGAISNLTSRYERETRVLADDG-W----GENEA--LtETVPTQVFDDTARSVLSKNTSPDVIFERSVNPYRGCEHACI 82  Azospirillum
WP_005411746  89 YCFARPSHSYLSLSPGLDFETKLFAKTNAAERLRNELSRPNYQCAAIALGINTDGYQPIERSYQITRQCLELLAETRHPV 168 Stenotrophomona...
WP_019942207  79 YCYARNSHEYWGFSAGLDFETKIVVKKNAPQLLEKLFNSKKWVPHHIHISGNTDCYQPGEKKYRITRQLLEICLRYRNPV 158 Dyadobacter bei...
WP_010602357  82 YCYARNSHQYWGYSAGIEFERKIIVKKDAPILFKKFLEKKGWDASTISLSGNTDCYQPAERKFKLTRQLLEIALEYKQPI 161 Pedobacter agri
WP_008242883  86 YCYARNAHEYWGFSAGLDFERKIIVKKDAPQLFRKFLERKGWDASTISLSGNTDCYQPAERQFRITRELLEIALEYRQPI 165 Pedobacter sp. ...
WP_017731022  80 YCYARNSHQYWGFSAGLDFESKIIVKEQAARLLEKELRHKSWELRPIMISGNTDCYQPLERKFKLTRQLLQLLKDYRHPV 159 Nafulsella turp...
WP_014032760  84 YCYARNTHEYWGYSAGLDFERRILVKESAPELLETKIKHKKWKAQTIVLSGNTDCYQPAEQRFEITRKCLEVFLKYRHPV 163 Muricauda ruest...
WP_010585980 134 YCYARPTHEYLDLSAGLDFETKIFVKERAPELFRDWLARDRYRPEIVMMSGVTDCYQPAERHFQLTRKCLEVALAARQPI 213 Schlesneria pal...
WP_002645053  75 YCYARPFHEYLGYNAGLDFETKIMVKHDAAKLFRDFLSRSDWQPKLIAFSGITDCYQPAEREFKLTRQCLEVASEANQPI 154 Gimesia maris
WP_013627236  78 YCYARNTHEYLGMNAGLDFETRIFVKQEAAKLFREFLARDAWQPEPIIFSGVTDCYQPAERDFRLTRQCLEVAWECRQPV 157 Rubinisphaera b...
WP_014197736  83 YCFARPTHAYLGLSPGLDFETKIFRKARAAELLAAELRAKSYRCQPLALGANTDPYQPIEREQRITRAVLEVCRDFNQPV 162 Azospirillum
WP_005411746 169 SFVTKSALITRDIDLLAAMAKDRLVTVYFSVTTLDRKLSAKLEPRAAAPHARLRAMETLHKAGVPVGVLVAPVIPRITDH 248 Stenotrophomona...
WP_019942207 159 SILTKNALILRDLDILEKMARLNLVHAALSITSLNEELRSALEPRTVTGKRRLQVLKTLSEAGIPTGVMTAPIIPGLNDQ 238 Dyadobacter bei...
WP_010602357 162 GMITKNSLILRDKDILQEMARLNLCMVYVSINSLNEDLRQVMEPRTTTAKQRLKVVEELSKAGIPMGVVVAPLVPGLSDH 241 Pedobacter agri
WP_008242883 166 GMITKNALILRDLDLLSEMAKLNLCMVYISINSLNEQLRLKMEPRTATAKQRLKVVEALSSAGIPTGVMVAPLVPGLSDH 245 Pedobacter sp. ...
WP_017731022 160 GIITKNSLITRDVDILEEMAKHHLVHVYFSINTLNEELRGKMEPRTASARKKLEAMELLSQKGIPVGVMNAPVIPGLNDH 239 Nafulsella turp...
WP_014032760 164 GIITKNALVLRDLDILKELNKHQLVGVNISVTSLSEKTRRKLEPRTASIQKRLKTIQVLSENNIPVNAMLAPMIPGINSH 243 Muricauda ruest...
WP_010585980 214 AIVTKNALVTRDIDLLRQMAERNLVSVAISITTLDQALTRSMEPRTSSPRARLRALRELTDAGVPTHVMIAPVIPSLNDS 293 Schlesneria pal...
WP_002645053 155 GIVTKNALVVRDLELLTSMARRSLVHVSLSITTLDPQLAREMEPRTSIPAARLRAVRELSAAGVPTKVMVSPIIPGLNDH 234 Gimesia maris
WP_013627236 158 SIITKNALVLRDLDLLRNMASCGLVHVNVSITSLNAELVRQMEPRASIPAARLRAVQTLSQAGIPTRVMVAPIVPGLTDH 237 Rubinisphaera b...
WP_014197736 163 MIITKSALVLRDLDILAPMAAKGLVNVALSVTTLDRDLARRMEPRASTPARRLAAMRELTAAGVPVAVLASPMIPGLSDH 242 Azospirillum
WP_005411746 249 ELEAILEEAHGHGARAAGYVLLRLPNEIKDIWKEWLELHYPDRAEHVLSLMRQLHGGKEYDAAFGTRMRGTGPFADLLAQ 328 Stenotrophomona...
WP_019942207 239 EIPALIQAIAENGALWSHYTVVRLNGAISTLFEEWINHHFPDRAAKVLNQIKECHGGAVNDSRFGIRMVGEGSFAEHIRQ 318 Dyadobacter bei...
WP_010602357 242 EIPKILKAVASAGAIQAGYTVVRLNGAIAQIFEDWLQKNFPDRFDKVWHMIQSCHGGNVNDSRFGDRMRGDGHIAKMIRD 321 Pedobacter agri
WP_008242883 246 EIPTVLKAVSNAGAISAGYTVVRLNGAIAGIFEDWLRKNFPDRFEKVWHAIQSCHHGNVNDSRFGERMRGDGNIAQLIRD 325 Pedobacter sp. ...
WP_017731022 240 EIPEIIRQSAEHGARAAGYTIVRLNGSLGPLFGDWLRKNYPDRFEKVWNGICSLHAGKVNDSQWGRRMGGEGPLALAISQ 319 Nafulsella turp...
WP_014032760 244 ELLPLAKAVADHGALSFGLTVVRLNGAIGQIFSDWIKKAMPDRAEKVLHQIQDCHGGTLNDSRFGTRTKGEGKIAEQIHE 323 Muricauda ruest...
WP_010585980 294 QIPSVLKAASEAGATSAGYVLLRLPHTVKPVFLDWLAVALPNQRERIESRLRDTRGGKLYEADFSTRMTGRGQIADQIRQ 373 Schlesneria pal...
WP_002645053 235 EVPEILKAAKEAGAMSASYILLRLPLTVKPVFEEWLERTQPARKERVLSRIRQTRDGKLNNSEFGSRQRGTGEIAEQIGS 314 Gimesia maris
WP_013627236 238 EAPQILQAAREAGATDARYVLLRLPQTVEPVFREWLERNRPAEVTRVEGRIQHARGGEFNQSGWHTRMRGQGEIAERIGN 317 Rubinisphaera b...
WP_014197736 243 ELEAILTAAAEAGATQANYILLRLPLEIADLFEEWLREHAPNRADRVLSLIRQCREGNLYQSQFGSRMKGSGPVAELLSK 322 Azospirillum
WP_005411746 329 RFKKAHRSLGFA-KLPPLNTQLFQPprelSPQGQLF 363 Stenotrophomonas maltophilia
WP_019942207 319 LHDHCCRKYLAGrELPPLDTSQFMR----AGQMRLF 350 Dyadobacter beijingensis
WP_010602357 322 NFKLHCRLNGLNvKRIVLNHSLFKVp---NDQMSLF 354 Pedobacter agri
WP_008242883 326 SFKLHCRLNRLNeQRIQLDSSLFKVp---GTQFSMF 358 Pedobacter sp. BAL39
WP_017731022 320 LFRLAKRKYLSGrSMPAYNLQAFRR----GSQYTLF 351 Nafulsella turpanensis
WP_014032760 324 MAHLAKKRYFKGkTFPRLNMELHNQy--kDGQMRLF 357 Muricauda ruestringensis
WP_010585980 374 TFEVFANKYGLNqKHEELDTSQFVRpipkSGQMWLF 409 Schlesneria paludicola
WP_002645053 315 LFKVFCGKLELDrRLPALDYEQFKPpvtgKGQQWLF 350 Gimesia maris
WP_013627236 318 LFEIWRRKLGFE-NLQELTTDQFRPpr--iGQLKLF 350 Rubinisphaera brasiliensis
WP_014197736 323 RFKLACRRLGLNaRDAALNCADFKPpparGDQLTMF 358 Azospirillum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap