Conserved Protein Domain Family
AceI_fam_PACE

?
NF033663: AceI_fam_PACE 
AceI family chlorhexidine efflux PACE transporter
The AceI family of proton-coupled multidrug/biocide efflux transporters includes several shown to respond to the presence of the biocide chlorhexidine and improve resistance to it, among other biocides and antibiotics. Members of the family seen so far, including founding member AceI, have been chromosomal and restricted to the genus Acinetobacter.
Statistics
?
PSSM-Id: 411266
Aligned: 12 rows
Threshold Bit Score: 214.607
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004783926   1 MLISKRRLIHATLYEGILLVVIAILLSTLMHMPLEVTGALGIAMAVTSMFWNMLFNHYFEKFEAKHCLKRTIKVRIAHAI 80  unclassified Ac...
WP_004973261   1 MLISKRRWVHALSYEVILLVIIALALSYVFEMPMQVTGGLGIAMAVTSVLWNMLFNHYFEKFEAQHQLRRTFKIRVLHAI 80  Acinetobacter
WP_005178621   1 MLLSKRRLIHALSYELILLVIIALALSLIFKMPLEVTGSLGVAMAVTSVLWNMLFNHFFEKFEARRQLQRTVKVRILHAI 80  Acinetobacter
WP_004815658   1 MLISSRRIVHALSYEIILLVIIAIALSYIFQLPMEVTGTLGVAMAVTSVVWNMLFNHYFEKIEAKHQLKRTIKVRIAHAI 80  Acinetobacter
WP_004822192   1 MMISKRRVIHALSYEVILLVIIAIALSFIFEVPMEVTGVLGVAMAVTSVVWNMVFNHFFEQFERKRKLKRTIGVRILHAI 80  Acinetobacter
WP_005170461   1 MLISKRRLVHALSYEVILLVIIAIALSLIFNMPLEVTGALGIVMAVTSVIWNMLFNHYFEKFEAKRQLKRTIRVRILHAI 80  Acinetobacter
WP_005009116   1 MLISKRRIIHALSYEIILLVIIAIALSFIFEVPMEVTGTLGIAMALTSVIWNMIFNHFFEKFEAKRKLKRTVGVRMLHAV 80  Acinetobacter b...
WP_004927292   1 MLISKRRMIHALSYEVILLVIIAIALSFIFDVPLEVTGTLGIVMAVTSVFWNMIFNHFFEKFERKHQLERTVKIRILHAI 80  Acinetobacter b...
WP_004937309   1 MLISKRRLVHAFSYEGILLVIIAIALSFIFDMPMEVTGMLGIFMAVTSVIWNMIFNHYFEKVEHRLQWKRTVGVRILHAI 80  Acinetobacter soli
WP_005215446   1 MLISRRRLIHAISYEVILLVIIAIALSFIFSMPLEVTGILGVIMAVISVIWNMIFNHYFEKVEHKYQWKRTIPVRILHAI 80  Acinetobacter s...
WP_005082678   1 MLISKRRLIHAIVYEVILLVIIAIALSFIFDMPMEVTGTLGVFMAVVSVIWNMIFNNYFEKIEHKYNWERTVPVRILHAV 80  Acinetobacter h...
WP_004866088   1 MLISKRRLVHALSYEIILLIIIAIALSFIFEVPMETTGSLGIAMAVTSVLWNMLFNHYFEKAEQKYKFKRTIPMRIVHAI 80  Acinetobacter g...
WP_004783926  81 GFEGGLMLATIPMVAYALQISLAQAFLLDLAMTLCILVYTFIFQWCYDHLEAKMGL 136 unclassified Acinetobacter
WP_004973261  81 GFEGGLMLATIPMVAYALEISLLQAILIDLLMTLSILLYTFIFQYCYDHIEAKLGY 136 Acinetobacter
WP_005178621  81 GFEGGLMLATIPMVAYAMQMSLPEAFLLDLSLTLCILVYTFIFQWGYDAIEVRLGY 136 Acinetobacter
WP_004815658  81 GFEGGLMLATIPMVAYALEMSLWQAILTDLSLTLCILVYTFIFQWCYDQIEIKMGI 136 Acinetobacter
WP_004822192  81 GFEGGLMLATIPMVAYAMDMSLWQAILLDFGMTTCILVYTFIFQWCYDLIEERMGA 136 Acinetobacter
WP_005170461  81 GFEGGLMLATIPMVAYAMNMGLWQAIVLDFSLTLCILVYTFIFQWCYDSIEEMLGY 136 Acinetobacter
WP_005009116  81 GFEGGLMLATIPMVAYAMEMSIWQAILLDFSMTMCILVYTFIFQWCYDHLEAHLGY 136 Acinetobacter bouvetii
WP_004927292  81 GFEGGLMLVTIPMVAYAMNMSLWQAIVLDFGLTMCILVYTFIFQWCYDTIEKRLGY 136 Acinetobacter baylyi
WP_004937309  81 GFEGGLLIATIPMIAYMMQLSLLDAFILDLGLTLCILVYTFIFQWCYDAIEKRLGY 136 Acinetobacter soli
WP_005215446  81 GFEGGLMLATIPIIAYMMKMSFIDALILDFGLTMCILVYTFIFQWCYDVIEERFFP 136 Acinetobacter sp. ANC 3862
WP_005082678  81 GFEGGLLVATVPMIAYMMNMTIVEAFILDIGLTLCILVYTFIFQWCYDTVENRFFP 136 Acinetobacter haemolyticus
WP_004866088  81 GFEGGLMLATIPMVAYAMQMTLLEAVILDFSMTMCILVYTFIFQWCYDTIEQHLGI 136 Acinetobacter gerneri
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap