Conserved Protein Domain Family
adhesin_LEA

?
NF033647: adhesin_LEA 
LEA family epithelial adhesin N-terminal domain
LEA (Lactobacillus epithelium adhesin), as characterized in an adhesive commensal strain of Lactobacillus crispatus (ST1), is a large, repetitive protein with an N-terminal YSIRK-type signal peptide and a C-terminal LPXTG site for processing by sortase and attachment to the cell surface. Family members contain variable numbers of an 82 amino acid long repeats similar to Lactobacillus Rib/alpha-like repeats. This HMM describes the N-terminal region upstream of the repeat region, just over 600 amino acids long.
Statistics
?
PSSM-Id: 468127
Aligned: 9 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EIA32243                   1 MKKNR-INFKEKRRYAIKKVSGKTASVFIGATIFGIILSSNLSIVNTK-ADTVsnTTATTISNDQTSETSnvvtlgnnqk 78  
CBL49691                   1 MKRLKfLETKRTPRYSLRKFSVGVASVLLGVTIFGINFTNHSVKAATI-ESVKtnTQKATSATEKVQQNG---------- 69  
WP_108454179               1 MKRPEfLETKRTPRYSLRKLNVGVASVLLGVTIFGINFTDHSVKAATt-EKVQ--QTttq-------------------- 57   La...
PTM26986                   1 MKRPEfLETKRTPRYSLRKLNVGVASVLLGVTIFGINFTDHSVKAATT-ETGP---SISANSTRQnpafv---------- 66  
WP_005729334               1 MKQLKfLETKRTPRYSLRKFSVGVASVLLGVTIFGINFTNHSVKAATi-ESVK--TSNSSPETQGsasnna-------ta 70   La...
PWF24304                   1 MKQLKfLETKRTPRYSMRKLNVGMASVLLGVTIFGINFTNHSVKAATt-ESVE--NSNSSAKSRLQQITTqeetsatekv 77  
PRJNA326401:BHF65_04500    1 MKKNR-IDFKEKRRYAIKKVSGKTASVFIGATIFGIILSSNLSIVNTKaDTVSn-TTATTISNDQTSETSnvvtlgnnqk 78  
WP_081540949               1 MKKNR-INFKEKRRYAIKKVSGKTASVFIGATIFGIILS-------Sn-LSIV--NTKADTLSnttatt---------ii 60   Li...
WP_109242364               1 -MKKNrIDFKEKRRYAIKKVSGKTASVFIGATIFGVILSSNLSIDNTKaDTVSn-TTATTISNDQTSETSnvvtlrnnqk 78   Li...
EIA32243                  79 aessASNN--ATEKVQ--QssaskNATAN---NSTEAATTSQSAPNTQGSAVTDIRslDIRSLTAISAAklatmnltqtn 151 
CBL49691                  70 ----ASNG--VPEKVQ--Q-----NGASN---GVPEKVQQSQSSPETQGSAGTDINssAFMNLMAASDT----------- 122 
WP_108454179              58 --eeTS----ATGEVQ--RssgsnTATAN---NSIEAATTLQSAPNTQGSADT-----DIRSLTAISAAklatmnlmqng 121  La...
PTM26986                  67 lttqTNT-----------Qget----sgQ---TSTQGETSGQTN--TQG------------------------------- 95  
WP_005729334              71 nnstEAATtpQSSPET--QgsasnNATAN---NSTEAATTSQSLPKTQGSAHTYIRslAAR-----SAArlaatnf---- 136  La...
PWF24304                  78 qqttTQEAtgATGEVQ--QssaskNATAN---NSTEAATTLQSSPNTQGSADTDIKslDIRSLTAISAAklatmnlmqtn 152 
PRJNA326401:BHF65_04500   79 aessASNN--ATEKVQ--QssasnNATAN---NSTEAATTSQTTPKTQGSADTDIK-----SSTAKSAAklafmnlmaas 146 
WP_081540949              61 snkqTSETs-SVGTLR--Dnqk----neN---SSNEAAGSVQ---NVTSNTESNVSaeNKAPSTESATPkldtpe---vs 124  Li...
WP_109242364              79 nensSNE---AADSVQnvTsntesNVSAEnkaPSTESVALKSDTPEVSAPAES---------SVNTSAApemrmat---- 142  Li...
EIA32243                 152 ginGTDTGrtAAGTSGTVTGS-----------YRSAAATVTPGNINTQPDKENQELANKHNLTSSDNYSSNIYQGTDGKY 220 
CBL49691                 123 ---GTDTG--AGTGTGTNTGR-----------DRSAVATVTSGNINDQPAKENQKLANEHNLTSSDNYSSNIYKGTDGKY 186 
WP_108454179             122 tdtDGN-------AAGTPGTG-----------DRSAAVTVNPDNINTQPAKENQKLANEHNLSSSDNYSSNIYKGTDGKY 183  La...
PTM26986                  96 ---------------ETSASNnttetqgsagnERNAAGTVDQNNINTQLAKENQKLANDNNLTSSDNYSSNIYKGKDGKY 160 
WP_005729334             137 --------------------------mvtsgsDRNAAGTVDQNNINTQLAKENQELANKANLTSSDNYSSNIYKGTDGNY 190  La...
PWF24304                 153 ginGTDTDgsATGTSGTGTGS-----------DRNAAGTTDQNNINDQSAKENQKLANDHNLTSSDNYSSNIYKGTDGKY 221 
PRJNA326401:BHF65_04500  147 gtgTDTGTgtNTGS------------------DRNAADTVDQNNINDQPAKENQKLANKTNLTSSDNYSSNIYQGKDKNY 208 
WP_081540949             125 aptGSNANasAAPATSTTTGS-----------DRNAAGTVNQDNINTQPAKENQELANKTNLTSSDNYSSNIYQGTDGKY 193  Li...
WP_109242364             143 --------------------------stttgsDRNAAGTVDENNANTQEAEENKKLANETGLTSSDNYSSNIYKGTDGNY 196  Li...
EIA32243                 221 YKIVTIYGNDYVYHTADIQANGTAFA-QWATSAEDTKNNINISKEDLGNGKTRWTVVFFPHKGLQNVGSNLSGLSSAKFG 299 
CBL49691                 187 YKIVTIYGNDYVYHAADIQANGTAFG-QWATSAADTKSNINISKEDLGNGKTRWTVIFFPNKGLQKAGDTLHGLSSAKFG 265 
WP_108454179             184 YKIVTIYGNDYVYRAADIQASGANLLgRPKQTAEDIKNNINISKEDLGNGKTRWTVVFFPNKGLQNYHDTLHGLSNAKFG 263  La...
PTM26986                 161 YKIVTIYGNDYVYRAADIQANGTAFG-QWATTAEDTKNNINISKEDLGNGQTRWTVTFFPNKGLQNVGSNLSGLTSAKFG 239 
WP_005729334             191 YKIVTIYGQDYVYRAADIQASGADFKgDPKQTAEDTKNNINISKEDLGNGKTRWKVVFFPNKGLQNVGSKLSGLSSAKFG 270  La...
PWF24304                 222 YKIVTIYGNDYVYHAADIQANG------DDTTAEDTKNNINISKEDLGNGQTRWTVVFFPNKGLQNVGSHLSGLSSAKLG 295 
PRJNA326401:BHF65_04500  209 YKVVTIYGNDYVYHAADIQANGTARG-QKATTAEDTKNNINISKEDLGNGKTRWTVVFFPNKGLQNVGGSVHGLVSAKFG 287 
WP_081540949             194 YKIVTIYGNDYVYRAADIQANGTAFL-QKATTAEDTKNNISISKEDLGNGKTRWTVVFFPHKGLQNVGSSLSGLTSAKFG 272  Li...
WP_109242364             197 YKVITIYGKDYVYRPVKVYANGTATG-QWATNERDTRANIITTKEDLGNGKVKWTVVFFPSKGLTKDNSTISGLQSAKFG 275  Li...
EIA32243                 300 IALTNDYQIVGDVDMDITTDPNQTFVAHTFKDNSNRATDITVSNPSPEVKFSFNPNTDVDPNTGLIN-SKTMPAYNNQYL 378 
CBL49691                 266 IALTNDYQIVGDVDMDITTDPNQTFVAHTFKDNSNSSTDITVSNPSPEVKFSFNPNTDVDPNTGLIN-SETMPAYNNQYL 344 
WP_108454179             264 IALTSDYQIVGNVDMDVISDPKQSFVSHTFKDNSNSATNIPVQNPSPEVKFSFNPKTDVDENTGLIN-SKTMPAYNNKYL 342  La...
PTM26986                 240 IALTSDYQIVGNVDMDVISDPNQTFMSHTFEPGSSSATDWPVQNPPAKVKFSFNPNTDVDPNTGLINnSKTLPAYNNKYL 319 
WP_005729334             271 IALTSDYQIVGNVDMKVISNPNQTFESYTFEPGSTSATEFPIQNLKTEKDFSFNPKTDVDPNTGLIN-SETMPAYNNQYL 349  La...
PWF24304                 296 IALTNDYQIVGNVDMDVISDPNQSYVAHTFKPGSYSATDITVQNPPTEVDFSFNPKTDVDQNTGLIN-SKTMPAYNNKYL 374 
PRJNA326401:BHF65_04500  288 IAITNDYQIVGNVDMEVINDPNQKYTYYKFEDGSNSATDITIKNPPAEVDFSFNPKTDVDPNTGLINnSKTLPAYDNRYL 367 
WP_081540949             273 IALTHDYQIVGNVDMDVISDPNQTFLSYSFKSGSNSATDIPVQNPPAEVKFSFNPNTDVDPNTGLIN-SKTMPAYNNKYL 351  Li...
WP_109242364             276 VALTKDYRIIGDVTVNIDSIADAGHTYTAMDGHGHEKSFTPEAN----VVQSFNPNTDVDL-SGWIN-SSTMPGENNDYI 349  Li...
EIA32243                 379 QGPYYFNTDAYAGRRNLWQTYFEDG----VEYNNAYDENIPYLGGNHDFHLNNFEIKN-KTG-VDGAKQGNK-------- 444 
CBL49691                 345 QGPYYFNTAADAGRRNLWQTYFEDG----VEYNNAYDGTPPYLGGNHDFHLNNFEIKN-KTG-VDGAKQGDK-------- 410 
WP_108454179             343 QGPYYFTTATSAGTNNLWQTYFKd----aDERKNAYDYTTPYLGGNHDFHVNTFKIAN-ETG-VDGAKYGDS-------- 408  La...
PTM26986                 320 QPSYYFTTATTTGAINLWQTYFFNHrn-dVKYYNAYDG-SPYLGYGHDFHFNNFEIKN-RTG-VDGAKFGDK-------- 387 
WP_005729334             350 QGPYYFTTATDVGAKNLWQTYFKd----aDERKNAYDGS-PYLGGNHDFHFNTFKIAN-ETG-VDGAKYKDP-------- 414  La...
PWF24304                 375 QGPYYFTTATDTGKKNLWQTYFKKWgvfsNGSNNAYDGS-PYLGNDHELHFSDFNIRN-KTG-VDGAKQGDL-------- 443 
PRJNA326401:BHF65_04500  368 QPSYYFTTDTSSGKTNLWQTYFKDG----VENNNAYDGTTPYLGGVHDFHFNNFIIKN-KTG-VDGLESKDLkdpkaqip 441 
WP_081540949             352 QGPYYFTTATNTGAKNLWQTYIFNHrndvKYYN-AYDGS-PYLGGGHDFHLNNFEIKN-KTGdVDGAKNGDK-------- 420  Li...
WP_109242364             350 LGPYYFNTDTSVGEKNLGNTFFKEEt----VNKNAYTG-ENFVGEVHDLWTDNYTIRNeDKNaLDGGDYYKKh------- 417  Li...
EIA32243                 445 IIYDTLGYRLNSKN--ANPNGVFSSDNFNQAMEFKSQGVTDQ------SQFSSYKISFTTQHTDSYEVGLTAGPKNQQFS 516 
CBL49691                 411 IIYDTLGYMLNSKN--ANPNGVFSSHNFNQAMEFKSQGVTSQ------SQFSSYKISFTTQHTDSHEVELTTGPKKQQFS 482 
WP_108454179             409 IIYDKRGG----------VNGVFNSVNFNQAMEFKSQGFTGNg----qSQFSSYKISFTTQHTDSHEVELTTGSKNQQFS 474  La...
PTM26986                 388 IIYDKLGYRLNSKNgvANSNGVVNSDNFNQAMEFKSQGSTGNs----qTQFSSYVISFTTQHTDSHEVELATGWKNQQFS 463 
WP_005729334             415 IIYDKLGYRLNSKNgvANSNGVYSSDNFNQAMSFKSQGVTSn------AQFSSYVISFTTQHTDSHEVELTTGSKNQQFS 488  La...
PWF24304                 444 VIYDKLGY--DKFNgkLNSDGVFSSYNFNQAMEFKSQGVTSq------AQFSSYVVSFTTQHTDSYEVNLDKGPKNQQFS 515 
PRJNA326401:BHF65_04500  442 IIYDTR----NEFNs----NGVFNSVNFNQAMEFKSHGYASKlvwndlSQHSSYVISFTTQHTDSHEIDLISGPKNQQFS 513 
WP_081540949             421 LIYDELGYRLNSKNgvANSNGVFSSDNFNQAMEFKSQGSFDq------PQFSTYVISFTTQHTDSHEVELATGWKNQQFS 494  Li...
WP_109242364             418 LIYDPLFNEKGGIYk----dGFFNSGDFGSAMIFKSQGKTNT------AQFSSFTISFVAQHTDSYQSDLAKGPNGQQFS 487  Li...
EIA32243                 517 GIAANIYSFQN-KYYNMFSRLYGEQRALNPADAAHPsP-LNPKDIIPNWQIGEDALAKINKAYLNNAQINALSSEIHNNA 594 
CBL49691                 483 GIAANIYSYQN-GYYNMFSSLYGEQRALNAADAAHPaP-LNPKDIIPNWQIGEDALAKINKDYLNNAQINALSSEIHNNA 560 
WP_108454179             475 GISANIYSFQN-GYYSMMSSLYGEQRALDPAGAT-----VEAKKIIPHWGDVKPYMDKIKQNYLNNAQINVLRNKILNNI 548  La...
PTM26986                 464 GISANIYSYQNaGYYNMFSRLYGEQRALTPADAAEPyVpLNPKDIIPNWVPANEAMKNIHNEYLNNAQINVLRNKILNNI 543 
WP_005729334             489 GIAANIYSYQN-WYYSMMSSLYGEQRALDPAGAP-----KTPKDVISGWVDATRALDEIKKDYLNNAQINVLRNKILNNI 562  La...
PWF24304                 516 GISANIYSYQN-GHYNMFSSLYGEQRALNAAGVA-----KTPKDVISGWVPANEAMGQIKQDYLNNAQINVLRNKILNNI 589 
PRJNA326401:BHF65_04500  514 GISANIYSYQN-SYYNMFSRLYGEQRALTPADAADPyApVNPKDIIPNWVPANEAMGQIEKDYLNNAQINVLRNKILNNI 592 
WP_081540949             495 GISANIYSYQDiGYYNMFSRLYGEQRALNPAGAP-----VKANDVVSGWDKSKDAMKNMHTDYLNNAQINVLQNKIQNNI 569  Li...
WP_109242364             488 GIIANTYSYQN-AYYNMYSIALGEQRSLKKVGKSyv--eTQPGDKIPNWQKGEDALARINKEYLNDEQINNLKNEIHKNI 564  Li...
EIA32243                 595 ANPDALAKIVDQGNALNDAMKKLGNSIGQYD------DGSFADHKEDTTKASDRYKYANPDKKAAYDNATEV 660 
CBL49691                 561 ADPDALAKIVDQGNALNDAMKKLGNSIGQYDh-----DGSFADHKEDTTKASDRYKYANPDKKAAYDNATEA 627 
WP_108454179             549 TDPDALNNIVSEGNSLNDAMKKLGNSIGQYDs-----DGSFADHKEDTTKASDRYKYASPDKKAAYDKATEV 615  Lactobacil...
PTM26986                 544 TNPDAVNNIIKEGNSLNDAMKNLGNSIGQYDp-----HGSFADHKVDKTKASDRYQYADSGKKSAYDTATDA 610 
WP_005729334             563 TDSDAVNNIIKEGNSLNDAMKNLGNSIGQYDp-----DGSFADHKEDTTKKSDRYKYASPDKKAAYDNATEV 629  Lactobacil...
PWF24304                 590 TDPDAVNNIIKEGNSLNTAMKNLGNSIGQYDp-----DGSFADHKVDTTKASDRYQYADSDKKSAYDTATDA 656 
PRJNA326401:BHF65_04500  593 TNHDAVSNIIKEGNSLNDAMKKLGNSIGKYVdpkddpEGFWAKHKEDTTKESDRYKYANPDKKAAYDDATEV 664 
WP_081540949             570 TDPDAVNNIIKEGNSLNDAMKNLGNSIGQYDs-----DGKFTDHKVDTTKASERYKYADSKKKSAYDTATDA 636  Ligilactob...
WP_109242364             565 ENSELIEQIVTTGNDLNDSMKALGNSVGIYDd-----NNEYTNRIVDNVKNSDKYIYASKEKQKAYDDAVIA 631  Ligilactob...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap