Conserved Protein Domain Family
urate_HpxO

?
NF033623: urate_HpxO 
FAD-dependent urate hydroxylase HpxO
HpxO is an FAD-dependent urate hydroxylase (EC 1.14.13.113). Like the factor independent urate hydroxylase (EC 1.7.3.3), it consumes O2 and converts urate to 5-hydroxyisourate, which decomposes spontaneously to allantoin and CO2. However, HpxO oxidizes NADH to NAD(+), and produces H20, while EC 1.7.3.3 produces H202 as a byproduct.
Statistics
?
PSSM-Id: 468115
Aligned: 44 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011507082  14 DVLVIGAGMGGLSAALAFQRQGHRVTVIERVEAIRPVGAAISLWPNGVKVMHRLGLGETIEHLSGNMTRMRYLTHTGEPL 93  Chromohalobacte...
WP_015153020   5 KVVIIGAGIGGLTAGIALRQAGYEVEIYDRVKELRPAGAGISLWSNGVKVLNRLGLGEKMAAIGGLMDRMQYLTLKGDVL 84  Chroococcidiops...
WP_009555251   5 KVIIIGAGMGGLTAGIALKQAGYEVEIYDRVSELRPAGAGISLWSNGVKVLNRLGLGKEIAAIGGQMNCMEYRTATGELL 84  Oscillatoriales...
WP_008313210   5 KIVVIGAGIGGLTAGIALTQAGFEVEIYDRVRELRPVGAGISLWSNGVKVLNRLGLGQRMAAIGGQMNRMAYRDKTGTLL 84  Leptolyngbya sp...
WP_009625268   5 KAIVIGAGIGGLTAGIALRQAGYEVEIYDRVRDLRPIGAGISLWSNGVKVLNRLGLGEKIAEIGGQMNRMEYRHLSGNLL 84  Pseudanabaena
WP_015158329   5 KVIIIGAGIGGLTAGIALKQAGYEVEIYDRVATLRPVGAGISLWSNGVKVLNRLGLGAEIAAIGGEMNAMTYRSKTGELL 84  Chamaesiphon mi...
WP_017287003   5 KVVIIGAGIGGLTAAIALSQSGHTVEVYERAQELRPRGAGISLWSNGVKVLNRFGMGKDIAEIGGQMDFMQYLSTSGEVL 84  Leptolyngbya
WP_017299482   5 KVVIIGAGIGGLTTGIAMRQAGYQVEIYDRAQELRPAGAGISLWSNGVKVLNYLGLGEKLAAIGGEMNAMEYRSHTDESL 84  Nodosilinea nod...
WP_015228209   5 KVTIIGAGIGGLTTGIALKNIGYDVEIYERTRELRPAGAGISLWSNGIKVLNRLGLGEKVAAIGGEMNRMEYRSHTDEQL 84  Dactylococcopsi...
WP_015169222   5 KVAIIGAGIGGLTAGIALRRMGYSVEIYDKASALKPAGAGISLWSNGVKVLNWLGLGEAIAAIGGRMDRMEYRTHTNELL 84  Synechococcus s...
WP_011507082  94 TDFSLAPLFDEVGQRACPIARAALQQTLFDAVGA--EHIQLGRRCLDYAQDDEGVTAHFEDGGRQRADLLVIADGTHSRL 171 Chromohalobacte...
WP_015153020  85 SDIDLHPLVEEVGQRPYPVARTDLQQMLLEAYP---GEVKLEHKCIAVEQDENSVTAIFENGHRTTGDLLIAADGVRSLL 161 Chroococcidiops...
WP_009555251  85 NAIDLLPLVHEVGQRPYPVARTDLQQMLLKAFP---GEVKLGYPCIGVEQDDHQVTAIFENGHRATGDLLVAADGIRSNC 161 Oscillatoriales...
WP_008313210  85 NDIDLLPLMEKVEQRPYPVARADLQAMLLDAFP---GEVHLNHRCIEVEQTGDGVTAVFENGHRATGDLLVAADGVRSQI 161 Leptolyngbya sp...
WP_009625268  85 NEISLAPLIASVGQRPYPVARRDLQNMLLESFESlgSKVTLGAKCIEVVESDRNVTAKFEDGSTATGDVLVAADGVHSIL 164 Pseudanabaena
WP_015158329  85 NQIDLMPLIDRVGQRPYPVARRDLQTMLVAAFP---GEVHLDHKCIDFEEYETGVTAIFENGHRTSGDLIIAADGIRSQF 161 Chamaesiphon mi...
WP_017287003  85 NHVNLHPLIEEVGQRPYPVARADLQAMLLKKFP---GTVNLGYRCLSVEEHGEQVTAQFENGHKATGDLLIAADGVRSSL 161 Leptolyngbya
WP_017299482  85 SYVDLRPLFEQVGQRPYPVSRTDLQSMLLDTFGP--EDVHLGMNCVGVEQDEHTATAIFENGDRATGDLVIGADGIHSAV 162 Nodosilinea nod...
WP_015228209  85 SAIDLRPLVDRVGERPYPVARTDLQQMLRDAFGK--DKLHLGCKCVGVEQDETSATAIFEDGDRVKSDLIISADGIHSTI 162 Dactylococcopsi...
WP_015169222  85 SDIDLNPLFARVGQRPYPVSRSDLQRILLDAFGE--ENVQLQSKCIGITEEADGVTAIFEHGHSTKVDLLIGADGIHSLA 162 Synechococcus s...
WP_011507082 172 RSKLVGhPVERQYVGYVNWNVRVSADEALAPAASWDQYVGDAKRVSLMPMGTggnaagtQEYYCFFDVPLPVGTPNDASR 251 Chromohalobacte...
WP_015153020 162 RTYVLGqEVQPNYGHYVNWNGLVPASEDLAAKNSWVIFVGEHKRASMMPVAG-------DRFYFFFDVPLPKGTVSSPEN 234 Chroococcidiops...
WP_009555251 162 RKYVLDeDVMPKYGGYVNWNGLVPVSEDLAPKDTWAIYVGEHKRASMMPVAG-------DRFYFFFDMPMSKDEAQQPGD 234 Oscillatoriales...
WP_008313210 162 REQVLGyQVEPQYGGYVNWNGLVATSEDLAPRDCWVIYVGDHQRASLMPVGG-------DRFYFFFDIPLPKGTPAEPEQ 234 Leptolyngbya sp...
WP_009625268 165 REYILKeRVSPQYGGYVNWNGLVPISEDLAPADMWAIYVGEHKRASMMPVAG-------DRFYFFFDVPLAKGTTSDRAN 237 Pseudanabaena
WP_015158329 162 RKQILDePVEPKYAGYINWNGLVPADEQLAPKNTWSIYVGEHKRASLMPVGD-------SRCYFFLDVPLPPDNCATPDS 234 Chamaesiphon mi...
WP_017287003 162 RQYVLDrEVHPTYRDYVNWNGLVAADEALTPANTWTIYVGNHQRASLMPVGG-------DRLYFFFDVPLPLGTSAPPEL 234 Leptolyngbya
WP_017299482 163 RAYVVGsCVDRRYARYVNWNGLVKADPELCEKDLWVIYVGDSKRASMMPVGG-------DRFYFFFGAPMAEGTEVAPTH 235 Nodosilinea nod...
WP_015228209 163 REYVTG-EVTPRFADYVNWNGLVAASDDLCEADNWVIYVGEGKRASMMPVGD-------NRFYFFFGCPMKQGTVVEPED 234 Dactylococcopsi...
WP_015169222 163 RTYVAGsEVEPRYADYVNWNGLVAANPNISPSDVWGIYVGEGKRASMMPIGG-------DRFYFFFGAPMPKGTVVEPCD 235 Synechococcus s...
WP_011507082 252 YRAELREHFAGWAAPVHALIERFDPDRMARVEIHDIPPLDSLTAPRVALLGDAAHGMAPDLGQGGCQAMEDAWVLARAVQ 331 Chromohalobacte...
WP_015153020 235 YRAELTEHFQGWAQPVQNLIQRFDPYKTNRLEIHDVGPIDRMVRGRVALLGDAAHATCPDLGQGGCQAMEDGLVLTQYLL 314 Chroococcidiops...
WP_009555251 235 IRDDLTKFFGGWAEPVQRLIQRLDPEKTNRVLIHDLGPLEQMVRGRVALLGDAAHATCPDLGQGGCQAVEDALVLTNYLM 314 Oscillatoriales...
WP_008313210 235 YRAVLSEHFQGWAEPVQRLIERMDPTTVARPEIHDVGPIDRLVRGRVVLLGDAAHATCPDLGQGGCQAMEDGLVLAQYLM 314 Leptolyngbya sp...
WP_009625268 238 YQTELKAYFQGWAEPVQLLIDRLDPATVARVEIHDVGPISKMVQGRVALLGDAAHATCPDLGQGGCQAMEDGLVLTNYLV 317 Pseudanabaena
WP_015158329 235 YRAELKEHFRGWDEPVQQLIDRLNPAETARIAIHDMGPIDRYVKGRVALLGDAAHGTCPDLGQGGCQALEDAWVLSNYLI 314 Chamaesiphon mi...
WP_017287003 235 IRSELAEHFKGWAEPVQTLIERINPEQTNRLEISDVGPVDRMVRGRVALLGDAAHATCPDLGQGGCQALEDVYMLNHFLL 314 Leptolyngbya
WP_017299482 236 RQDELANIFRGWPERVQKLIQAIDSEQTNRLEIGDIDPLENLVKGRIALLGDSAHATTPTLGQGGCQAIEDAEVITRYLV 315 Nodosilinea nod...
WP_015228209 235 RQKELKDIFAGWPQAVRNLIDRLNPLETNRLEIADLDPLDTLVKGRVALLGDAGHATTPTLGQGGCQAIEDAEILSRYLV 314 Dactylococcopsi...
WP_015169222 236 RQLELKNLFYNWATPVQNLIMQINPLETNRLEISDLDPLEHIVRGRVALLGDSAHASTPTLGQGGCQAMEDAEILCRYLI 315 Synechococcus s...
WP_011507082 332 DALEDgaapaaaiatALDHYDAARVDRVGDIVSRARKRAAMIHGRDPVQTHAWYDELAHEDGDEILAGLRKTIVGGP 408 Chromohalobacter s...
WP_015153020 315 TTNISme-------yALKRYEADRKERTSAVVEKARKRAEMIHGKEPEITQKWYQQLAQEEPADVRGAIAKVILAGP 384 Chroococcidiopsis ...
WP_009555251 315 STTVSve-------dALKRYEAERVQRTGAVVQKARKRAEQIHGKDPEITQKWYDQLSQESPADVRRAIAKVILGGP 384 Oscillatoriales cy...
WP_008313210 315 TTNMGla-------yALGRYEGERKERTSAVVTKARKRAEMIHGKDPAVTEKWYRQLATESPTDVTDAIAQIILAGP 384 Leptolyngbya sp. P...
WP_009625268 318 STNVSvv-------dALTRYEAERKTRTTEIVNKARNRAETIHGKDPAATQKWYEQLAQENPLDVTTAIAKIISGGP 387 Pseudanabaena
WP_015158329 315 ATNISvp-------dALKRYESERKERANAVVAKARQRAEQIHGRDPDVTQAWYQQLKNEPPEDVTSAIAKTILGGP 384 Chamaesiphon minutus
WP_017287003 315 TTNISve-------dALKRYEAAREDRTRSIVKKARNRAEVIHGKDPEVTAQWYDQLRQESPSDVTDAIAKTILTGP 384 Leptolyngbya
WP_017299482 316 TTNIGva-------dALNRYEAARKDRTADLALKARKRTSTIYGHVPEATQQWYSDLKQEPPEAVINALAKVILGGP 385 Nodosilinea nodulosa
WP_015228209 315 STNISvs-------dALKRYEQARKDRVSQLVLKARQRTDTIYGKDENVTAAWYKQLEQESESNVIDALAKVILGGP 384 Dactylococcopsis s...
WP_015169222 316 TTNLSve-------dALIRYESDRKERTNSLVLKARKRADIIYGKDPEATQQWYASLKQEDEKDVINALAKVILAGP 385 Synechococcus sp. ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap