Conserved Protein Domain Family
repair_DdrC

?
NF033622: repair_DdrC 
DNA damage response protein DdrC
DdrC is a DNA-binding protein that seems restricted to the genus Deinococcus, and that plays a role in the ability of members of that genus to recover from fragmentation of their DNA. Note that the region where DdrC is found in Deinococcus radiodurans R1 originally had incorrect structural annotation, with a feature designated DR_0003 shown on the opposite strand.
Statistics
?
PSSM-Id: 411241
Aligned: 7 rows
Threshold Bit Score: 353.361
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_019011411              1 MKSLPNTLEFGTVRLPASADGLLHAPTALLQLGLTvpvSDWTTFAAQHDLHSAQRDFGV--GPEATLHPDEFARLAFVLT 78  Dein...
PRJNA315481:A2G07_00380   1 MKNAPLTLNFGSVRLPVSADGLLHAPTAQQQLGLT---QSWEAALVEHGLPETYRDFGA--GPEAAVSVPDFVALAFALD 75  Dein...
WP_014683481              1 MKNASLTLEFGTVRLPVSADGLLHAPTALGQLGLDp--ADWTTLAATHDLNDDPRDFGA--GPEAALSVPDFARLAFMLD 76  Dein...
WP_012694483              1 MKSLPNTLDFGNVRLPVSADGLLHATTALAHLGLEt-pEQWDEFAHTHQLTSPLRDFGA--GPEPTLHPDEFTRLAFVLD 77  Dein...
WP_013615464              1 MKNAPLILEFGSVRLPVSPDGLLRASSALDQLDAGr--VDWDWFSDKHGLRSPKRDFGD--GPEPTLSVAEFTALAFRLD 76  Dein...
WP_013555218              1 MKSVMPFVQLGAHRVPTSTDARLHAATALRILGLEd--AAWADLARTHHLPDEPRDFGA--GPEATLSLQDFLRVAVTTP 76  Dein...
WP_015235437              1 MYAVSLT-KLGKYTARTSPDGRLSALDALRALGEDe--GNWELLCAKYDLGTGHYDFGAphGAEPTLSYDQFSLLAFALQ 77  Dein...
WP_019011411             79 TPEAKRWRKRAQTLLARAMQGDVRLSAQIAERNPDPEARRWLAARLESTDARRTLMSTVARHGGEGNVYGQLGSISNRSV 158 Dein...
PRJNA315481:A2G07_00380  76 TPEARRWQKRARELLARAMQGDVRVAAQIAERNPEPDARRWLAARLESTGARRELLATVARHGGEGRVYGQLGSISNRTV 155 Dein...
WP_014683481             77 TPQARRWRKRAQELLARAMQGDVRLAAQVAERNPDPEARRWLAARLESTGARRELMSTVARHGGEGQVFGQLGSISNRSV 156 Dein...
WP_012694483             78 TIEARRWRKRAQTLLSRAMQGDVRLSAQIAERNPDPEARRWLAARLESTHARRELLSTVSRHGGSGQVYGQLGSISNRSV 157 Dein...
WP_013615464             77 TPAARRWRKRAQDLLGAAMQGDVKLAAQIAERNPDPAERRWLAARLESTEARRELMSTVARRGGHGPVYRQLGSLSNRSV 156 Dein...
WP_013555218             77 TRQGRAWQARALDTLARALSGDVHLAADIAERNPSPQERHWLSARLENAEARKSLMNAIARSGGSGAVFGQIGSVSNRSV 156 Dein...
WP_015235437             78 TPEAKRWRVRAREMLAGYLEGDVRLAAEIAERNPEGEKRRWLSARLESVEARKRFMSTVARHGGEGSVFQQVSSLSNRSV 157 Dein...
WP_019011411            159 LGTDSATIRRERGVKQTRDGLSSAELLRMAYVDTATERAIQDHGAHGNTAILRLHEHVARRERHLWD 225 Deinococcus aquat...
PRJNA315481:A2G07_00380 156 LGKDSASVRQERGVKATRDGLTSAELLRLAYIDTVTARAIQESEARGNAAILTLHEQVARSERQSWE 222 Deinococcus radio...
WP_014683481            157 LGVSSADIRRARGVKNTRDGLSSTELLRLAYLDTATARAIQERGAHGNAAILRLHERVARHERQGWQ 223 Deinococcus gobie...
WP_012694483            158 LGTDSATIRRERGVKQTRDGLNSTELLRMAYLDTATARAIQEHGAHGNAAILRVHEQVARRERLGWE 224 Deinococcus deserti
WP_013615464            157 LGMNSTALRRERGVKNTRDGLSSAELLRMAYLDTATARALEERDVQGNADILAVHGETLAREQRLWD 223 Deinococcus prote...
WP_013555218            157 LGTDSATIRRERGVKHTRDGLTTGELMRLTYLETLTARDLDAGRAHGNDAILDLHRRNAQRERLAWD 223 Deinococcus maric...
WP_015235437            158 LNMNSAAFRRERGVRDTRDGMTASELMRLTYLETASAQAIEAHAARGNEQILELHRKNADNERKVWQ 224 Deinococcus perar...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap