Conserved Protein Domain Family
pqiC

?
NF033620: pqiC 
membrane integrity-associated transporter subunit PqiC
PqiC (YmbA), a lipoprotein, has been identified as part of the PqiABC system, a transporter that bridges the inner and outer membranes in species such as Escherichia coli and is important to membrane integrity.
Statistics
?
PSSM-Id: 468113
Aligned: 70 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_017490510   3 KWIPVVLALFLAACSSD-GKKTYYQLPTvNs-SAPVAVVSAGggltpaaQKPKLWISQVSVADFLGTSGLVYQTNDVQYV 80  Rouxiella badensis
WP_012765267   3 KRWSLLLLLLLGAC--SsPQKNYYQLPAvTa--sSAVVSKTSg--------RQLLVAPVTLTDALAGNGIVFQTSDVRYT 70  Musicola paradi...
WP_011146046   3 RRLALILVIFISACSRq-PEKTYYQLPVvA--IASQKSAIVQ-------HDRQLWVQRVMLSDYLSSSGVVYQSSDVSYV 72  Photorhabdus
WP_015834882   3 KRLALILVIFISACSNq-PEKTYYQLPTvK--IASQNSAAIQ-------HDRQLWVQRIMLSDYLSSSGVVYQSSDVSYI 72  Photorhabdus as...
WP_004918199   2 RYLISIFVLMLAACSSt-PEKVYYQLPVkSpaTQSAVVMGQ---------QNQIWLQRIMLADVLTSNGITYQTSDVSYN 71  Providencia
WP_008911859   2 RYLLSIFVLMLAACSSt-PDKMYYQLPVkPpaTQTATVMSE---------QNQIWLQRVMLADVLTSNGITYQTSDVSYS 71  Providencia bur...
WP_004256133   2 RYLLSIFVLLLAACSSt-PEKKYYQLPMkTpqTQSAEVMD----------KGQVWLQRIMLSDVLTSNGITYQTTDVSYT 70  Providencia
WP_006813551   2 RYLLSIAVLLLAACSSt-PEKMYYQLPMkApeAQQAVVMG----------KGQVWLQRVTLSDVLTSNGITYQTSDVAYT 70  Providencia
WP_006662140   2 KYLLAIGVFLLAACSSs-PDKVYYQLPMkApeVQSATVMG----------KGQVWLQRITLADVLTSNGITYQTSDVAYS 70  Providencia
WP_006537371   2 RYIIGIFVLMLTACSSq-PEKTYYQLPDiYqtGVSAQVTTTQs-----aKKPQIWVQPIRLSSMLVNAGIVYQTTDINYT 75  Proteus
WP_017490510  81 MAANNLWASPLDQQLQQTLQTYLGRNLPGWVVSGQQASDGnQEQLSVNVTGFHGRYDGTAVISGTWTLTRDGQVSQHNFN 160 Rouxiella badensis
WP_012765267  71 LTTQNQWASPLDQQLQLALLTALRSGLPGWDVTTSGAG-AtPVTLQVNVTAFQGRFDGRAIVRGEWVLRDKSRVVTQPFN 149 Musicola paradi...
WP_011146046  73 SAANHLWASPLEQQLQQVLVAELTMALPQRLVSAQPLVNK-PDTLDVTVTSFHGRYDGKVILQGYWTLTHQGSVVKQPFN 151 Photorhabdus
WP_015834882  73 SAANHLWAGPLEQQLQQVLVAELTMALPQRLVSAQPLVNK-PDTLDVTITGFHGRYDGKVILQGYWTLTRQGGVVKQPFN 151 Photorhabdus as...
WP_004918199  72 NASSHLWASPLEQQLGQSMVSELSSALPGRLVSLQPLQNS-PDTLDITLTSFNGRYDGKVLVQGFWTLSRGKEIIRRNFD 150 Providencia
WP_008911859  72 NASSHLWASPLEQQLGQSMVSELSSALPARLVSLQPLQNS-PDTLDITLTAFNGRYDGTVLVQGFWTVSRGKEVIRRNFD 150 Providencia bur...
WP_004256133  71 NASTHLWASPLEQQLGQSMVRELSAALPEKLVSLQPLQNS-PDTLDITLTAFNGRYDGKVLVQGFWTYSHNNNVIRRNFD 149 Providencia
WP_006813551  71 NASAHLWASPLEQQLGQSMVRELSAALPDRLISLQPLQNS-PETLDITLTAFNGRYDGKVLVQGFWTLIQGDSIVRRNFD 149 Providencia
WP_006662140  71 NASAHLWASPLEQQLGQSMVRELSSTLPDRFISLQPLQSS-PETLDITLTAFNGRYDGKVLVQGFWTLMRGDKVIRRNFD 149 Providencia
WP_006537371  76 VANQHLWINPLDQQLQQNLISGLTKALPGTVVANQPVEDN-LAKLTVTVNYFQGRYDGQVIISGDWIYTENNKVINQPFS 154 Proteus
WP_017490510 161 IELKQNQDGYDALVRTLATGWEQEANSIALQIR 193 Rouxiella badensis
WP_012765267 150 VEVSLHEDGYDALVKALAQGWQQVSLSLAHQVA 182 Musicola paradisiaca
WP_011146046 152 LELKQEEDGYDDLVRTLAKGWSQLVQAIASQLI 184 Photorhabdus
WP_015834882 152 LELEQAEDGYDDLVRTLAKGWSQLAQAIASQLT 184 Photorhabdus asymbiotica
WP_004918199 151 IQLEQKEDGYPELVRTLADGWQQVASEIAKEAN 183 Providencia
WP_008911859 151 IQLEQKEDGYPELVRTLSNGWQQVADGIAKEIS 183 Providencia burhodogranariea
WP_004256133 150 VQLDQNEDGYPELVRTLSMGWQQVAESIAKEID 182 Providencia
WP_006813551 150 IQLDQSEDGYPELVRTLASGWQQVASDIAKEIS 182 Providencia
WP_006662140 150 IQLEQQEDGYPELVRTLASGWQKVAVDIAQEIN 182 Providencia
WP_006537371 155 LVLPQTEDGYPALVRTLGQGWEQVISDIAKAIQ 187 Proteus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap