Conserved Protein Domain Family
CDF_MamB

?
NF033616: CDF_MamB 
magnetosome biogenesis CDF transporter MamB
Statistics
?
PSSM-Id: 411235
Aligned: 12 rows
Threshold Bit Score: 452.55
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_041039480  11 CQECRDRAAWLDMFTALALAVFKTALGVLSGSMALQAHSLHSFGDFLTKGINLASVKLSSRPANSAFPYGYGKVQFLSAN 90  Magnetospirillu...
KJR44072      18 CKECSQRAAWIDLFVALGQTIFKTIVGILSGSTALFIHGVHSLADFLTKIITIISVKISSRDSTHHYPYGYGKIQYICSA 97  Candidatus Magn...
WP_085440038   6 CKECRDQVTWFSIFTNVFLVFYKGTLGVLSGCQALVADAFHSSADVIASSVTMVSLKVSNKPADSDHHYGHGKIQFISSS 85  Magnetofaba aus...
WP_011713872   6 CRNCRDTVTWYSIVSNLILVVIKGVLGVISGCQALVADAFHSSADVMASTVTLASLKISERPADDDHHYGHGKVQFISSS 85  Magnetococcus m...
CRH04729       6 CRNCREQVTWYSIISNIFLVIIKGVLGTISGCQALVADAFHSSADVMASAVTMASLKISAQPADEDHHYGHGKVQFISSS 85  magneto-ovoid b...
AEX00091       6 CKNCREEVIWWAFFVNIAQTVFKGILGLLSGSAGLLADSLHSGADVVASAVTMFSIKMSSKPADSKYPFGYGNIQYISSA 85  alpha proteobac...
WP_068494573   6 CRDCREEVVWWAFTADICMTLFKGVLGLMSGSVALVADSLHSGADVVASGVTQLSLKISNKPADERYPFGYGNIQYISSS 85  Magnetospirillu...
AFX88985       6 CKECRNEVVWWAFFVNIAQMTYKGLLGVMTGSAALIADAMHSGADVVASSVTMASLKISAKPADERHPYGYGNIQFISSS 85  gamma proteobac...
WP_046020684   6 CRKCRDEVIWWAFFINIGQTTYKGVLGVLSGSAALVADAMHSGADVVATLVTMFSVKVSDKKADEKYPFGYGNIQFIASS 85  Magnetospira sp...
WP_069188719   6 CKQCKEEVVWWAIVVNIGQMTYKGVLGALTGSVALVADSLHSGADVIASIVTMLCVKISKRKASDKYPYGFGNIQFISSS 85  Candidatus Tera...
WP_069957861   6 CKICRDEVIWWAIAVNIAQTSFKGILGLMSGSAALVADSIHSGADVIASIVTMASVKISKKVSNENYPYGFGNVQFISSS 85  Magnetovibrio b...
CAX83800       6 CRRCRNEVVWWAIIVNILQTAYKGLLGLMTGSTALLADSLHSGADVVASTVTMISVRISRREPNEKFPYGYGHIQFISSS 85  uncultured bact...
WP_041039480  91 FIGISLMVGAAAMLWYNVSHLGSGHVQVPEVWAVFGALISAGTAELMHRYLRCVAEHTNSPAIMAAAADNRGDAYSSLAV 170 Magnetospirillu...
KJR44072      98 VVGVSLIIGACGFLAESISNIKSNDIVSPNKLSIFAAILTIIAYELMHRYLLCVGTENNSPALLASAWHNRADAYSSIVV 177 Candidatus Magn...
WP_085440038  86 IVGTILIIGAIFILIDAIRAIYTGDYGAPDRIAIVGAAISVAMNELMFRYQSCVGRENNSPAIMANAWDNRSDAYSSIAV 165 Magnetofaba aus...
WP_011713872  86 IVGLILITGAIFILIDAIKTIVTGDYDAPNRIAILGAAISVISNELMFRYQSCVGKQNNSPAIMANAWDNRSDAFSSIAV 165 Magnetococcus m...
CRH04729      86 IVGLILITGAIFILIDAIKAIVTGDYDAPNRIAILGAAISVASNELMYRYQSCVGKENNSPAIMANAWDNRSDAYSSIAV 165 magneto-ovoid b...
AEX00091      86 IVGMILLFGAIFLMYESVLKIISGNIEAPSIIAAVGAAVTIITNELMYRYQVCVGTENNSPAIIANAWDNRSDALSSAAV 165 alpha proteobac...
WP_068494573  86 IVGTLLLIGASFLMYGSVMKLISGSYEAPSIFAALGASVTVIVNELMYRYQICVGNENNSPAIIANAWDNRSDAISSAAV 165 Magnetospirillu...
AFX88985      86 IVGLILILGAIYLIYESFMAILAGEISAPNVAAVLGAALSALTNELMYRYQSCVATENNSPAIMANAWDNRSDALSSLAV 165 gamma proteobac...
WP_046020684  86 IVGLILFFGALYLMYESTMQIIAGNTSSPSPFAVLGAIVSIATNELMFRYQSCVGRQNNSPAIIANAWDNRSDALSSVAV 165 Magnetospira sp...
WP_069188719  86 IVGIILILGAIYLMYESILKIIDGNIEAPSGLAVLGAGMSVVVNELMYRYQHCVGRENNSPAIIANAWDNRSDALSSVGV 165 Candidatus Tera...
WP_069957861  86 VVGLILIFGALYLMYEAVIKLVIGDITPPSGVAIFGAVVSILTNELMYRYQNCVGLENNSPAIIANAWDNRSDALSSVGV 165 Magnetovibrio b...
CAX83800      86 IVGLILFFGALYLMYETVLKIVSGDITPPSVVAVLGAAVSIVTNELMFRYQNCVGQQNNSPAIIANAWDNRSDTLSSAGV 165 uncultured bact...
WP_041039480 171 LAGIVLSILGWVAADHLAAILVSLLVLRIGAVIAWDSIHGLMDGSVPSHRIEGIRQLLAAHHPGVSVVDLRGRRMGETWE 250 Magnetospirillu...
KJR44072     178 LLGIALSLIGWSAADMWSAVLVSILVIKIGAEISYSSYEGLMDVSIPKETLTTIKQLAETTVGVKRVLNLRGRQIGETWE 257 Candidatus Magn...
WP_085440038 166 LVGIVFATFGFPIADPLAALMVSLMVIRIGVELNVDAIDGLMDASPEMDELQSIYNVVSKAKGVMGISYMRARTLGEDLH 245 Magnetofaba aus...
WP_011713872 166 MIGVAFATFGFPVADPLAALGVSVLVIRIGIELNLEAIDGLMDASPEMEELEDIYKIVKDVSSVHGINYMRARTMGDNLH 245 Magnetococcus m...
CRH04729     166 MVGVAFATFGFPIADPIAALGVSILVIRIGVELNLEAVDGLMDASPEMEELEDIYKIVKDVSSVHGINYMRARTMGDKLH 245 magneto-ovoid b...
AEX00091     166 LAGVVASVIGFPIADVLAAIGVSLLVGKIGIELISESVKGLMDTSVDVDILKTVWSICMDDENVQNIYFLRGRNVGEEIH 245 alpha proteobac...
WP_068494573 166 MVGVIASVIGFPIADTIAAIGVSALVGRIGLELIGTSVHGLMDSSVDTELLQSAWQIATDTPMVHSIYFLRGRHVGEDVQ 245 Magnetospirillu...
AFX88985     166 LVGILVAVMGFPIADNLAAIAVGFMVVRIGVELNTDAISGLMDSSIEIEDLKEVYDLVNEIDGVEGIAYLRGRNVGEDLH 245 gamma proteobac...
WP_046020684 166 LIGIVAAVVGFPIADRLAAIGVGILVAKIGIELNIDAINGLMDTSVENDVLVDAYNIAKDSQHVHGVHYIRGRNVGEDVH 245 Magnetospira sp...
WP_069188719 166 LIGIMFAVLGFPIADVVAAMVVAILVARIGIELNIDAIDGLMDTSVEMDVLKDVYAIAVNVPKVDEVRHLRGRNVGEDIH 245 Candidatus Tera...
WP_069957861 166 LIGITIAVLGFPIADVLAAMIVSVMVARIGVELNIDAVNGLMDTSVETDLLTDVYTIAIETPKVDEVQYLRGRNVGEDIY 245 Magnetovibrio b...
CAX83800     166 LVGIGIAVMGYPIADVLAALFVAVLVAKIGIELNIDAIGGLMDKSVEMDALTVAFNIASHTPRVVDVQYVRGRNVGEDMH 245 uncultured bact...
WP_041039480 251 VDLQLSISSRVTVEECHALTRELESRIAREEPHACHIRIRFIPQ 294 Magnetospirillum magnetotacticum
KJR44072     258 TEIHIEVDGKISTIDSHSIAEALKQTIHDNLNHIKHISVTIVPE 301 Candidatus Magnetoovum chiemensis
WP_085440038 246 VEVNVHVPADLKVYEGDLIVDLLKQQVMREIDHIGQLEVFLTPV 289 Magnetofaba australis
WP_011713872 246 VELNVEVAEALKVYEGDLIVDLLKRRIFQEVKHIGELQIFLTPL 289 Magnetococcus marinus
CRH04729     246 VELNVEVAKELKVYEGDLIVDLMRRRILQEMKHIGELQVFLTPV 289 magneto-ovoid bacterium MO-1
AEX00091     246 LDIRLRVSPDMKVKDSTAVAESLKAQIQDEIPHAREIRLFVSPA 289 alpha proteobacterium LM-1
WP_068494573 246 FDIRLRVDANLRVKDSSAVAEAVRQRIQEEIPHARDIRLFVSPA 289 Magnetospirillum marisnigri
AFX88985     246 VEINIKVNRNLSVAESDQISDWVTEKIEYEVGHVKDVLVLLTPV 289 gamma proteobacterium SS-5
WP_046020684 246 LDINIYVDADLKVFESDLVADAIRRKIEAEVDHVRDVHVGVTPV 289 Magnetospira sp. QH-2
WP_069188719 246 LDISIAVDGKLKVFESDLIIQALKERIYAEVRHVTDVQIAVVEA 289 Candidatus Terasakiella magnetica
WP_069957861 246 LDIGICVNGKLKVYESDLIVAAVKKRIFEEIEHTSDIQVTVVPH 289 Magnetovibrio blakemorei
CAX83800     246 LDIAVCVEKGLKVYEADLIAEAVKERIFMELVHATDVQVSVVPS 289 uncultured bacterium
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap