Conserved Protein Domain Family
His_racem_CntK

?
NF033599: His_racem_CntK 
histidine racemase CntK
CntK (cobalt and nickel transport system protein K) is a histidine racemase that performs the first step in the biosynthesis of staphylopine, a metallophore involved in the import of multiple divalent cations. It was first characterized in Staphylococcus aureus.
Statistics
?
PSSM-Id: 411221
Aligned: 14 rows
Threshold Bit Score: 448.31
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_099089888   3 SKRIQFSKYNPSGNMTVLVHSKHDKASYVSIANQIMQTSHICCEQVGFIESDQSDAQQHFHLVMSGNEFCGNAAISFMHY 82  Staphylococcus ...
WP_069995413   3 KRRVQFSKYNPTGNMTVLVHSEHNRTEYAEIANQMMQTSHVCCEQVGFIESVRFENCQNFKLVMSGNEFCGNATISFLHY 82  Staphylococcus ...
WP_096824679   3 RQVVEFSKYNPSGNMTILVHSKHQPSEYAAIAHQLMATTHVCCEQVGFIESVNYENGDNYHLVMSGNEFCGNATMSYIHY 82  Staphylococcus ...
WP_038679292   3 RKVIEFSKYNPSGNMTILVHSQHDSRDYANIANQLMTTSHVCCEQVGFIESTNTDFNRNCHLVMSGNEFCGNATMSYIHY 82  Staphylococcus ...
WP_001081687   3 RQVIEFSKYNPSGNMTILVHSKHDASEYASIANQLMAATHVCCEQVGFIESTQNDDGNDFHLVMSGNEFCGNATMSYIHH 82  Staphylococcus ...
WP_017637780   3 RQVVEFSKYNPSGNMTILVHSQHCPSDYARIANQLMASTHVCCEQVGFIESMKQDSGETFRLVMSGNEFCGNATMSYIQY 82  Staphylococcus
OMP24114       3 RQVIEFSKYNPSGNMTILVHSQHHPNDYAKIANQLMASTHVCCEQVGFIESNNLNHGDDCRLVMSGNEFCGNATMSYMHY 82 
WP_016999743   3 KKVIDFSKYNPSGNMTVLVHSKHHPSEYADIANCMMKFSHVCCEQVGFVSSTRDG---LYKLEMSGHEFCGNATISYLHY 79  Mammaliicoccus ...
WP_103207121   3 QGNVVFSKYNPSGNMTVLVHSTHPKSHYVNIANQLMATEHICCEQVGFIEK---GHHDKLKLVMSGHEFCGNATISFLHY 79  Staphylococcus ...
WP_103345823   2 KDIVHFSKFNPSGNMTVLVDSEHDASRYVSIANQLMQTSHVCCEQVGFVIKPQSSD-DLYGLQMSGNEFCGNATLSLLHY 80  Staphylococcus ...
WP_099089888  83 LNEQRRISTtgkrhesnlTQFQMQISGRSDLVECNIHHDGYYEVMMPQPETIVQRQLTLDNQSFFATAVRYESYVHYVIH 162 Staphylococcus ...
WP_069995413  83 LNEQHLIKAteqlnalkqHTLQIQVSGRSDLVDCKVHNDGYYEVSMPQPQCVDQVQLTLRNQSITATRINYESYLHYVIP 162 Staphylococcus ...
WP_096824679  83 LKERLLIQH---------QQFQLRVSGCSHPVECKVH-SQHYEVTMPKVHQVKERFVKLGEQQFKALEISYDTYIHYVMM 152 Staphylococcus ...
WP_038679292  83 LQESNILQK---------HQCAIKVSGCTELVQCEVHSNQHYEVSMPQAQHVSPVKLNINQQQWHAIEIVYESYVHFVVP 153 Staphylococcus ...
WP_001081687  83 LQESHLLKD---------QQFKVKVSGCSDLVQCAIHDCQYYEVQMPQAHRVVPTTINMGNHSWKAIEIIYETYVHYVIP 153 Staphylococcus ...
WP_017637780  83 LKEHKLLTS---------KQCYVDVSGCEKLVPCTIHDYQLYEVGMPQAQQVSQEYLHIGQQVWQAIKVTYDSYVHYVIP 153 Staphylococcus
OMP24114      83 LQEHQRLTA---------QQCHLNVSGCDDLVPCTIHGHQQYEVGMPQAQYVTTEYLHIAQHMWQAIKITYESYVHYVIP 153
WP_016999743  80 LYEHNLLPH---------SKVELSVSGRADLVQCKICDDGKYEVNMPKPLSIQHLDLHISNVSYKAIEVIYESYVHIIVP 150 Mammaliicoccus ...
WP_103207121  80 LKTQQLLPS---------HQVDVEVSGRQDLVSCKVHHDNSYEVTMPSQKQITSTKLNMKDQVLSAKRIEYDSYLHFVVP 150 Staphylococcus ...
WP_103345823  81 LKERQLVQE---------SELSLHVSGVSTPTPCVIHALGDYEVTLPAPHTYEWQSLTLGTKTFDVLKITYASYCHFVVP 151 Staphylococcus ...
WP_099089888 163 IETQdiSNELQQSLEHFVRSTQWNNVFKTIGIMLFDRGAQFLTPLIYLPEVQSCIWEHSCGSGAASIGIVENDQKGNDIE 242 Staphylococcus ...
WP_069995413 163 IDHT--SQELQQEIEQFVRTTQWEQSLKTIGIMLFNRKEQYLSPLIYLPEVQSIIWENSCGSGTASIGIFEAYHTKRASE 240 Staphylococcus ...
WP_096824679 153 CDDV--DLAIKQCVEDFVSAQTWHRQFKTIGVMLFQQDKQFIYPLIHIPAIDSLIWENSCGSGAASIGVLVNYLTDHDIQ 230 Staphylococcus ...
WP_038679292 154 VTEV--TTELQHQVEQFVRQQTRSNKYKTIGIMLFDEQRQFLKPLIFIPEIQSLVWENSCGSGTASIGIFKNYKSNSTCE 231 Staphylococcus ...
WP_001081687 154 VKQV--TTEIQHLVETYVRKQQWNHKYKTVGMMLFDEQRQFLQPLIYIPEIQSLIWENSCGSGTASIGVFNNYQRNDACK 231 Staphylococcus ...
WP_017637780 154 IEEI--SPFIKHQIEQYVKNQQWDNQYKTIGIMLFHVQKQFLHPLIYIPEVESLIWENSCGSGAATIGVFNNYQSQNPCA 231 Staphylococcus
OMP24114     154 IEKI--TATFKQQVAQFVREQQWDEQYKTIGVMLFNVQDQYLHPLIFIPEVKSLIWENSCGSGAASIGVFNNYQSQRSCE 231
WP_016999743 151 VSEI--TDQLKRGVETYVRTYKWSHHLKTIGIMLFNTTTQYLVPLIYIPKVKSIVWENSCGSGSASIGIYETWYKQKTIH 228 Mammaliicoccus ...
WP_103207121 151 VQHI--NEEIKQAVEQFIQKTKWDVRFKTVGVMLYQHHNDYMEPFIYVPSISSMIWEQSCASGTASVGAYIHHQTGQSCH 228 Staphylococcus ...
WP_103345823 152 IASY--SEVMCQVVEAFVKHETWPSHFKTIGMMLYNADEHRLYPLIYVPELGSIIWEQSCGSGTGSIGIFEALNHTNGCA 229 Staphylococcus ...
WP_099089888 243 SLTVYQPGGHMIVTSKLEDKAtYNTTIKGKVATIATGTAYIE 284 Staphylococcus edaphicus
WP_069995413 241 SLVVHQPGGHIIVSTNFGGNN-YHTTIKGKVTSVATGTAYIE 281 Staphylococcus caeli
WP_096824679 231 DYLVNQPGGSIIVSSRKSGQNeYQTTIKGQVSTVATGQAYIE 272 Staphylococcus epidermidis
WP_038679292 232 DFIVHQPGGNILVTSRKCPKSgFQTSIKGQVSTVATGKAFIE 273 Staphylococcus xylosus
WP_001081687 232 DFTVHQPGGSILVTSKRCHQLgYQTSIKGQVTTVATGKAYIE 273 Staphylococcus aureus
WP_017637780 232 DYIVYQPGGSISVTSKHCPTHgYRTSIKGSVSTVASGKAYIE 273 Staphylococcus
OMP24114     232 DYIVYQPGGSISVTSAICSEDgYRTSIKGRVSTVARGQAYIE 273
WP_016999743 229 KLEIKQPGGSIWVSSN---IDdFETSIIGEVSTVAIGQAYLG 267 Mammaliicoccus lentus
WP_103207121 229 YRQISQPGG-ILSVSTKQNHNaYHTTIKGHVTTVATGTAYIE 269 Staphylococcus felis
WP_103345823 230 DVVVHQPGGALRVCAQMGESS--RITIRGHVKTVAMGLAYIE 269 Staphylococcus agnetis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap