Conserved Protein Domain Family
denti_PrtP

?
NF033595: denti_PrtP 
dentilisin complex serine proteinase subunit PrtP
PrtP, a chymotrypsin-like protease known as dentilisin, forms a complex with PrcB and PrcA. It is found in Treponema denticola and in numerous other Treponema species. Dentilisin from T. denticola plays a significant role in pathogen-host interactions in periodontal disease.
Statistics
?
PSSM-Id: 468104
Aligned: 15 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPF28338      11 LFFSAAVFVILTAGCSMGFVGTAPESdrIGGAQSGTMNANTAFNSEWIINQQERHNADERVHEGYSIVKTTASFNQDGFT 90  
AFV33668       5 ILFFLMTIVLIVSSCNFGMNTAVIGNkdNGTVLN--------------------KPDDNDIVEGYFIVKTKDGFDKTLFE 64  
WP_024469079   4 ILVLSAVLAILAGSCSFNIDPQNISS--NEQRVQSMEALYGNSSSVLP-----YAPKDEDTVDGFFIVKTKDGFDKTAFE 76   Treponema pedis
AAQ73568       5 ITILTAALGALFFACSPIVSGT-----------SSASAS--------FNEGTAYKPNANDIVEGFVIAKTADGFDKELFT 65  
ERF61561       5 LAILAAAFGALFFACAPVVNGS-----------AGFTAG-----------TMPYKPNKNDIVEGFVIAKTADGFDKTLFT 62  
WP_016521888   5 LTIFAAALCALFFACSPVINGS-----------ASFTAENASISSNSFNTSAVYNPNANDIVEGFVIAKTADGFDKTLFT 73   Treponema socr...
WP_021686483   5 ITILSAALCAVFFACSPVINNS-----------FTANGSN------SFSGGLPYKPHKNDVVQGFVIAKTADGFDKTFFE 67   Treponema leci...
OHD17597       3 KFFAVLAAALLLASCGSPYLNTPVTG---PAQVAGLT-VVPVTTDSDLLANLAVN-------YGYVIVKVASGFDTTNFT 71  
AAQ72849      12 FFITSALAAVF-AGCAMGFVNNSAKSdgTG-SVHGTADSNTVFNSKWIISQQERHDKGTVVREGYSIVKTVNSFNPDSFT 89  
WP_051306044  14 VLLVSASFAVLLAGCPAGFIQ-TGKGgtSG-VSGSTARP---FGAEWISEQQERRDENEKVNKDYSIVKAARFVNGDSFA 88   Treponema leci...
EPF28338      91 ALNGSVVGVQDLHDG-YLYFLIKTESDAAQFRTAVRAMDGVLYAQPDYHYDAPALVADDTARPPYRNlGTTGRGy----- 164 
AFV33668      65 KKGFIVKEKISLTDTgFTYWYLNKKGDNKKNLLRAASIEGVLSAEHDYKVVEPDGSKASNQNDGPVD-PFNAET------ 137 
WP_024469079  77 EKGFTVKGALPLTGTgFTYWYLNKEGNDKKNLSVISSVKGVISAESDYKVGPPDGIKVAKTVDG----GGLADI------ 146  Treponema pedis
AAQ73568      66 NEGIDVCGELSLTGTgFTYWYVHKNTGNEALLKSVYSIKGVLSADNDYKVVPPDVMKLKDVVLSASStEPVVST------ 139 
ERF61561      63 DKGIDVCGELSLTGTgFTYWYLHKNTGNEALLKSVFSIKGVLSADNDYKVASPKIVESKDIALSPSStEPVAST------ 136 
WP_016521888  74 DKGIDVCGELSLTGTeFTYWYLHKNTGNEALLKSVFSIKGVLSADNDYKVASPKIVESKDIALSPSStEPVAST------ 147  Treponema socr...
WP_021686483  68 NQGIEVYGKLSLAGTgFTYWYVHQDTSNDTLLQAVYAIEGVLCADNDYKVTPPDGIKQSDFS-SFAAgEPRIST------ 140  Treponema leci...
OHD17597      72 KLGADVASSMVINGN--QYYRLHKAEGVTKLVNSLRLTRGVYYADPELLSKRILPITADNTS------------------ 131 
AAQ72849      90 ALNGSVAAAQDLHDG-YLYFLIKTESDAAQFRTAVRTLEGVLYAQPDYHYDAPAAMVDNTARPPVRNrGAAGKGt----- 163 
WP_051306044  89 ALNGSVESTLDLHDG-YVYFLVKSAGDAAQFRDAVRKLDGILYAQPDYQYEAPQAMQSDDQ-PPYRTpKTISSAhsgsvk 166  Treponema leci...
EPF28338     165 -FGTQDGNLTEDPKADLADWGLTVTGALEAFKryDAHDAVHPVLAAIIDTGVNSLHEDFYD-------KTNHSIILYAKS 236 
AFV33668     138 -YDLTKGNYLDDPEANNADYGLSITEALKAYK--EIGYGTETVVAGIIDTGINMEHKDFKD-------ENGESIVLYAKS 207 
WP_024469079 147 -SRLINGDYSGDPIANNSDYGLSITEALKSYK--EIGYGDKTVVAGIIDTGINMTHKDFKD-------ENGNSIVLYAKS 216  Treponema pedis
AAQ73568     140 -RGLGDGNVLQDPVSDAEGYALAITKALQAYK--DISYGTNEVVAGIIDTGINMKHEDFK--------NGTESIVLYAKS 208 
ERF61561     137 -QGLGDGNVLQDPVSDAESYALDITKALQAYK--AVGYGDKDVVAGIIDTGINMLHEDFN--------AGSESIVLYAKS 205 
WP_016521888 148 -QGLGDGNVLQDPVSDAESYALDITKALQAYK--DIGYGDKDVVAGIIDTGINMLHEDFN--------AGAESVVLYAKS 216  Treponema socr...
WP_021686483 141 -QGLEQGNYLKDPISGKSAYSLDITKALQAYK--DIGYGDKDVVAGIIDTGINMLHEDFK--------AGSESIVLYAKS 209  Treponema leci...
OHD17597     132 -RALGDGNLALDPSSAYGDYALEITGALAAYAdpTIGYGTNQVVVAVIDTGINMAHRDFWDdkgtpdtADDTSIVIYAKS 210 
AAQ72849     164 -LGTADGNLDNDPKAALADWGLTATGALEAFKryDAK---YPVLAAIIDTGVNSLHEDFYD-------KNNKSIILYAKS 232 
WP_051306044 167 pLGTKDGDVNEDPKAALADWGLTVTHALEAFKeyDASDAKHPVLAAIVDSGVNGLHEDFYD-------AHG-SIILYAKS 238  Treponema leci...
EPF28338     237 SLHR------GSSVQYSPPQPVPLHENWDNHGHGTHCSGTIAAVGNNGKGICGVAHAHTKLITYRGLDASGG---DSYAT 307 
AFV33668     208 CATDst--ggTYIGDGSSFTEIPLGQNWDKARHGTHCSGTIAARGNNNIGIAGVAWKNTKLISYQSL--GVEgsgRTWSV 283 
WP_024469079 217 CVKSng---gTYIGNGNPFTEIPIGENWDKGAHGTHCSGTICARGDNNVGIAGVAWKNTKLISYQSLDVDGGg--SAWAV 291  Treponema pedis
AAQ73568     209 AKTSg----gSYIGNGNPFTEVPLDSNWDTDGHGTHCSGIMCALGDNNKGIAGVAWKKTKLISYQSLGFNGGg--TEWAV 282 
ERF61561     206 AQTSvd---gSYIGNGNPFTEVPLGSNWDTDGHGTHCSGIICALGDNDKGIAGVAWKKTKLISYQSLGCKGGg--KAWAV 280 
WP_016521888 217 ARTSg----gSYIGDGNPFTEVPFDSNWDTDGHGTHCSGIMCALGDNDKGIAGVAWKKTKLISYQSLGFKGGg--TAWAV 290  Treponema socr...
WP_021686483 210 AKTGpas-saPPIGDGDPFTEVPLNSNWDADGHGTHCSGIMCALGDNDKGIAGVAWKKTKLISYQSLGFAGGg--TTWAV 286  Treponema leci...
OHD17597     211 AFNKavdgtmTYVGADVPFVTIPAGENWDDEAHGTHVSGTIAARGDNNIGVAGVAWKNTKIISYKCFAEAEegsgADWSI 290 
AAQ72849     233 SLHR------GDATQYTNPIPISLDENWDNHGHGTHCSGTIAAVGNNGIGICGVSHANTKLITYRGLDASGG---DTYAT 303 
WP_051306044 239 SLHK------GSSAEYNPLQIIPINDNWDDVGHGTHCAGTIAAVGNNGKGICGVSHANTKLITYRGLGKTGG---SSYSV 309  Treponema leci...
EPF28338     308 YSCLSDLAQIITELRKEPGARDSAVFAGLP-SNVISYPKLTQKTVPVNLSLGGYAVHPYEVEMMNKALAAGILPVIAMGN 386 
AFV33668     284 YGAMADLTKIVKILRKPKAGRNPAEIAALPsYLQTTDFQITQKTVPVNMSLGGSYGSEFAFAVLTNAVKNDILPVIAMGN 363 
WP_024469079 292 YGALADLTRTVNILRKPKSDRTLDENNALPsYLKNEDFQITQKTVPVNMSLGGSYGTEFAFSVLTAAVKNNILPVIAMGN 371  Treponema pedis
AAQ73568     283 YGALADLTNTVEILRKAPSARTPADKAKLPsYIQNTIFQITQKTVPINMSLGGSVASEFAFDVLTTAVKNDILPVIAMGN 362 
ERF61561     281 YGALADLTNTVEILRKDPATRTAEEKAKLPsYMD-SNFQITQKTVPVNMSFGNSIGSEYAFSILTNALMHNVLPVIAMGN 359 
WP_016521888 291 YGALADLTNTVEILRKAPGARTSDDEAQLPsHIQNTNFQITQKTVPVNMSLGGSIGSEYAFSILTNALMHDVLPVIAMGN 370  Treponema socr...
WP_021686483 287 YGALADLTNTIEILRKVLATRTAADKVKLPsYIQNTNFQITQKTVPVNMSLGSSIGSDFAFAVLTNAIAHDVLPVIAMGN 366  Treponema leci...
OHD17597     291 YGALSDLTAYIIDQR--------------------TNHGFTQATVPVNMSLGGDFAGNFEYEMINYALANGVLPVVAMGN 350 
AAQ72849     304 YSCLGDLAEIITELRKGPGSRNSAVFAGLP-PDVINYPQLRQKTVPVNLSLGGPAGHPYEVEMMNKALAAGVLPVIAMGN 382 
WP_051306044 310 YSCLGDLAQIISELRKEPGSRNPALFAGLP-AEVSAYPKLTQKTVPVNISLGGYSIHPYEVEMMNKALAAGVLPVIAMAN 388  Treponema leci...
EPF28338     387 DGKTLAAYPAALQGILAVGATAMDDTRAAFSNGGTWMSVCAPGESIYSCGNGgsnwsnyhssdVKTSYRWMSGTSMATPF 466 
AFV33668     364 EGRYTAAYPAAFPGVLAVGATNGKDKKIHFSNSGAWISVSAPGDGIKSCGIY-----------GDDSYETMSGTSMATPF 432 
WP_024469079 372 EGRYTAAYPAAFPGMLAVGATNGKDKKVHFSNKGAWISISAPGDGIKSCGIS-----------GDDDYETMSGTSMATPF 440  Treponema pedis
AAQ73568     363 EGRYTAAYPAAFPGVLAVGATNGRDKKAVFSNKGAWISVAAPGEGIVSCFSTpy-------gnSTDSYVSMSGTSMAAPF 435 
ERF61561     360 EGRYTAAYPAAFPGVLAVGATNGKDKKARFSNNGAWISVAAPGESIISCGNS-----------TASSYVSLSGTSMAAPF 428 
WP_016521888 371 EGRYTAAYPAAFPGVLAVGATNGKDKKARFSNNGAWISVAAPGESIISCGNS-----------TPSAYVSLSGTSMAAPF 439  Treponema socr...
WP_021686483 367 EGRYTAAYPAAFPGVLAVGATNGKDKKARFSNRGSWISVAAPGESIISCGVS-----------DVNSYVSLSGTSMAAPF 435  Treponema leci...
OHD17597     351 DGMYQGQFPASYQGVLAVGATNGKDEKVHFSNSGHWISVSAPGFDILSTGNGgtmwn-vvddyRTTETQWMSGTSMATPF 429 
AAQ72849     383 DGKTLAEYPAALQGILAVGATTMDDTRAAFSNGGTWMSVCAPGESIYSCGNGgqnwanshspdVKSSYRWMSGTSMATPF 462 
WP_051306044 389 DGKTVASYPAALQGVLAVGATSMDDTKAAFSNGGSWISVCAPGDSIYSCYNNgtnwsntaapeLRKSYTWMSGTSMATPF 468  Treponema leci...
EPF28338     467 VTGVITYLLSIN--PDLSPYQIKALLENTADKIDRRSPYGQYdsrgfskwYGYGRVNVLNAANALKTGa-IPAEGSVYSE 543 
AFV33668     433 VTGTIAYLLSFDkaHDLTPYQIKALLEKTADKVDGATGFTDS--------LGHGRVNVYKAAKAIKDNn-IPPENGLYTE 503 
WP_024469079 441 VTGVISYLLSFNnaHNLTPYQIKSLLEKTADKVDGAVSFTEG--------YGHGRVNVYNAAKAIRENn-IPQVNEIYSE 511  Treponema pedis
AAQ73568     436 VTGLISYLLSFDnaRNLTPYQIKTLIENTADDK-GDAGFDES--------FGCGRVNVLEAVKKVRDNt-VPAANDFYGE 505 
ERF61561     429 VTGLISYLLSFDnaHSLTPYQLKTLIEKTADKIDGAASFDER--------FGHGRVNVFAAVDSVKKNt-VPAENDVYGE 499 
WP_016521888 440 VTGLISYLLSFDnaHSLTPYQIKTLIEKTADKIDGAASFDER--------FGYGRVNVLAAADSVQKNt-VPPANDVYGE 510  Treponema socr...
WP_021686483 436 VTGFVSYLLSFDnaRNLTPYQIKTMIEKTADKVDGVSSFDER--------FGHGRVNVLKAAQAVKDNt-VPATNDVYSE 506  Treponema leci...
OHD17597     430 VTGVIGYLLSFNn--TLTPYQIKTILENTAADKGAVGFDTDY---------GWGRVDVLAAADLVKNGv-IPAAGSTYTE 497 
AAQ72849     463 VTGVVTYLLSIN--PDLSPYQIKALLENTADKIDRGSPYGQYdsrgfskwYGYGRVNVLKAAEALVTGsnIPAEGSVYSE 540 
WP_051306044 469 VTGTLTYLLSID--PNISPYQIKTLLENTADKIDQLSPYGKYdvrgfskwYGYGRVNVLKAAQAIKSGs-VPAEGSRYSE 545  Treponema leci...
EPF28338     544 KAVKITVKKAGISQTKKQVWLYEKESGICAA---------VGLTDEhngavsFYGLRTGFAYEIGINDAGTYKTYPVTAT 614 
AFV33668     504 KEVQVKVTNDDGFGVEVVPCKITLVDEVTNAplay-vsglGNTPIT------FKGLIKGRSYSVYGALFGEVKKHTFTVA 576 
WP_024469079 512 GSVYVEVKNN----NEVIASKISLVDEETKVplay-vaglGNNPVVe-----FKGLVKGKSYSVYASLLKYAKKETFTAD 581  Treponema pedis
AAQ73568     506 GAVTVTVKQGGSL--VQVTEPLTLCDESTKVplay--ikpNNRPKIe-----FKGLVKGRQYSIFASYSNTTKKQTFTVS 576 
ERF61561     500 GTVKLEVTGLGS----PVNESVCIIDKAAHTplvy-vplkNSFGKId-----FKGFVKGRAYTLFVSDGTKVKQQDFTGG 569 
WP_016521888 511 GTVRVRLKNKGVY--IPIRDKVSLVDGTTNVplay--vgpNSQADVa-----FKGLVKGKSYSVFVTCGGETQKKDFTVD 581  Treponema socr...
WP_021686483 507 GTVTVRVIGLGS----PIKESLCLIDKALNIplvy--vpmNNSGKIp-----LKGLIKGKTYSVFISDGTKVKVQDFTAG 575  Treponema leci...
OHD17597     498 AKVVATVANTHASYTSPIASTDWVVDQMVSVynasnqfvclgKTNDtdgqveFRGLMPG-NYTLKTNYMDTVQSVAVTLA 576 
AAQ72849     541 KAVIITLKKAGAAQTKTPVWLYEKATGICAA---------VGLTDEtngivrFYGLRTGLEYEIGVNDAGTYKTYIVTAT 611 
WP_051306044 546 KAVIITVKKGGIAQKKKTVWLYEKPNGICAS---------VGITDEnngtirFYGLRTNTEYEIGINDAGTYKTLAVSAP 616  Treponema leci...
EPF28338     615 NDTDIEYIFP 624 
AFV33668     577 DNDIVIPFQF 586 
WP_024469079 582 GSDKTVTIQF 591  Treponema pedis
AAQ73568     577 GNDQDVFIEF 586 
ERF61561     570 TSDQTITIDW 579 
WP_016521888 582 GTDQYVDADF 591  Treponema socranskii
WP_021686483 576 ISDQTVMINW 585  Treponema lecithinolyticum
OHD17597     577 AADETAAFSF 586 
AAQ72849     612 NDSDIDYIFS 621 
WP_051306044 617 GYTDTSYDFN 626  Treponema lecithinolyticum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap