Conserved Protein Domain Family
transpos_IS4_3

?
NF033590: transpos_IS4_3 
IS4 family transposase
Statistics
?
PSSM-Id: 411212
Aligned: 21 rows
Threshold Bit Score: 464.46
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010947782  59 AAYRFFQNDAVSERKILDSHITKTIERAKNYPTILAIQDTSYISYKNHKKTEGLGIIAarvrsktTNFQTHGLVMHTTFA 138 Legionella
WP_000633033  59 GAYRFIRNPNVSAEAIRKAGAMQTVKLAQEFPELLAIEDTTSLSYRHQ-VAEELGKLGs-----iQDKS-RGWWVHSVLL 131 Proteobacteria
WP_010947831  58 GSYRFLRNKRVTASQIAEGGYQVTSWLSQRIPTLLAIEDTTTLSYTHQ-IKESLGDLGg-----pKEKSNRGFHVHTTML 131 Legionella pneu...
WP_011140150  53 AAYRFLDNPQCHPADIRQAHASATAGRLAALPLVLLIQDTTELNFTAHPHTTGLGHLSk--------PESQGLLVHSLLA 124 Gloeobacter vio...
WP_076611285  50 ATYDFWNSPYFHPSDIIAAQAKSTVERIKEHPIVLAVQDTTSLDFTTQKAKKGMGYLDy--------KKSFGLKVHTTLG 121 Microcystis aer...
WP_076612417  54 AAYRFFQNENVKEGDILASHVAKTVERTKAHKKIFVIQDTSYISYTDHEKTSGLGVITr--------KHSQGIIMHTALA 125 Legionella
WP_010946384  52 AAYRFFNHVNVNPESILLPHSEATLERIKAEKIVLIPQDTTEVDFTGRKSLSGMGYLSn--------ERSRGLYLHPSIA 123 Legionella pneu...
WP_012701870  51 AAYRFFDHEKATFETVLTPHRDATLQRMECCPVVLLVQDTTELDKWVSLGPKGVGTLKe--------QQKYPRRLHPTVA 122 Azotobacter vin...
WP_011235908  39 GAYRFLGNDEVDWQAILAPHWERTRSRMRAHPVVLCLQDTTELDFNGQ-GIAGLGRLNy--------EARRGMYLHPTYA 109 Aromatoleum aro...
WP_020935938  72 ATYRFCDNDSVDPNEVLSAHKQQQQSRVSRSDELLIVSDTTELVFPRHPSKEGLGDIGn------SEMDLEGVKLHSTIG 145 Halorhabdus tia...
WP_010947782 139 VTTEGL-PIGLLDQKISSRPLLDETVKELKKRshniaLPIEEKESMRWIESLEHSNN-YPDLKNAKVVTVCDREADIYDL 216 Legionella
WP_000633033 132 LEATTFrTVGLLHQEWWMRPDDPADAD--------------EKESGKWLAAAATSRL-RMGSMMSNVIAVCDREADIHAY 196 Proteobacteria
WP_010947831 132 MDAEQEkTIGLIAQERWCRDIKERGKKNHRRV-----RLYTEKESYKWEKNTRELER-RLGSKMSDVISVCDREADIFEY 205 Legionella pneu...
WP_011140150 125 VRPDAV-ALGLCWQKVWTRAAQVEHLAARrq-----kRPQQHKESQRWLDGLAAAKG-YVP-PGGEAVLIGDRESDMFGL 196 Gloeobacter vio...
WP_076611285 122 VSPQGI-PLGLINQYVWAREEKNLGIAKQrk-----kRETEEKESQRWLDSLSETQQ-QIP-EDIQVVTIGDCEADIFDL 193 Microcystis aer...
WP_076612417 126 VSIEGL-VLGILDQKIYSRPEESENIKKKnn----dsIRIEDKESIKWLETLSNTNN-IIDSTQTETITICDREADIYEF 199 Legionella
WP_010946384 124 FTPERV-CLGVVEMQHWIRKEIGTRNSRKGKS-------IEEKETYCWLKGYNAANKiALAVPDTMVVSISDREGDIYEV 195 Legionella pneu...
WP_012701870 123 FTPERI-CLGVVEALWWSRDEPSPRKARRGKG-------VDEKESRRWIDSYQASCAlQGQIPKTQLVNLADAEGDLYEW 194 Azotobacter vin...
WP_011235908 110 VTPERE-PLGVLDAWMWAREDVD----EPGER-------TSIKESARWPEGYERVAElATGMATTRLVYVADREADLMEM 177 Aromatoleum aro...
WP_020935938 146 INPRTHrMTGVIDQQALIEDQQAGEKYDANGKa---ePIQLDNEHEKWSRGDRQARDwLAD--DIRPLFIHDRGADSFAF 220 Halorhabdus tia...
WP_010947782 217 FEVASTNQ----CPFVVRARQDRTVNKTSIYskks---gekLWDLVSGSPCRGEIQVTIPArd---------nKPKRTAT 280 Legionella
WP_000633033 197 LQDKLAHN----ERFVVRSKHPRKDVESGLY----------LYDHLKNQPELGGYQISIPQkg---------vVDKRGKR 253 Proteobacteria
WP_010947831 206 IQYKLDNH----QRFIVRASHNRKLEGSYGY----------LFQMLPSATILGTYTIAIAQka---------nRKKRQAA 262 Legionella pneu...
WP_011140150 197 FAAPRPPQ----LHLLVRAARQRRLATPKTl----------LFEVFAGASAQGHYRCDLARrp---------gRAARQAR 253 Gloeobacter vio...
WP_076611285 194 FAQSRSPN----SHLLIRGTHNRKVNYLEDKqksghpepkyLHQSIREIKACGSLDVQVKRnp---------nHEARLAK 260 Microcystis aer...
WP_076612417 200 FELAHNLN----SAVLVRASKDRAVNRKSRYpekg---eqkLWEFIKSSHCAGTVKVEVPAkd---------nKPKRTAH 263 Legionella
WP_010946384 196 LEKLPSEEn--kAYWLIRCQHDRAVLNEETNqfe-----llLKKEVSKACVLGTIEFEIPAgtsyrnckkrhtRKARSVR 268 Legionella pneu...
WP_012701870 195 FTEYAEVApstrAQWIVRAAQDRRVLTGDADklw-----asLAMAPG----LGQLAVEVRArp---------kRPARQAR 256 Azotobacter vin...
WP_011235908 178 MLRAQTLGt--pADWLVRAKHNRCLP--EGAklw-----shTCAGEP----LGEIVFTMGSrh---------gQKAREVR 235 Aromatoleum aro...
WP_020935938 221 YEEVTGEMe--sAGFIVRANQNRRIWTDDGEpe-------kLFDWSSDLAEQGRKTIEIQQgg---------gREARTVE 282 Halorhabdus tia...
WP_010947782 281 LEVRFDHFVMNPPKNNVKrktrtLPDLKLNAVYVIEqSPPLgEEPMNWMLLTNIDINNFEEAVEKIQWYCLRWRIEIFHK 360 Legionella
WP_000633033 254 KNRPARKASLSLRSGRITlk--qGN-ITLNAVLAEEiNPPKgETPLKWLLLTSEPVESLAQALRVIDIYTHRWRIEEFHK 330 Proteobacteria
WP_010947831 263 LELKTASVTFSLPERRAKar--eLKPITLNVVIAKEkNPSEsDC-LEWVLLTTEATTTLECARKITRYYEMRWRIEDFHK 339 Legionella pneu...
WP_011140150 254 LQVYWQAVQLQPGRN--DqthkgQPPVSVWVVRAWEvDPPAgEEGIDWWLLSSQPVTTLEQALACVHRYTLRWLIERYHY 331 Gloeobacter vio...
WP_076611285 261 LTVRFASFEIQVPKH--HskanpRQPVKLQVILAEEeNPRPgVNPISWLLLTSLDISSFESAITCVRWYSYRWLIERYHF 338 Microcystis aer...
WP_076612417 264 LEVRFGKFIMHPSKNSIRhkteeLLKLPHYAVYVVEkDFPSeTSPLEWMLLTNLPVNTFDEAVEKVRWYCLRWKIEILHK 343 Legionella
WP_010946384 269 QEIRICSVSLRPPRRks----kkLNVIEIQVVHCKEiNTPEgEQPVEWFLITSVPIKTLDRAVEIVNWYLCRWLIEMYIK 344 Legionella pneu...
WP_012701870 257 VTLRSATVVLRPPARig----rhLPEVSVNAVLAREeNPPEgVEPLEWLLLTSLPVGSLEQASTIVAWYAVRWYIEIYFH 332 Azotobacter vin...
WP_011235908 236 QQLWARRVSLPag---------kAGTVSATCIVAREiGAPAgTKPVEWRLLTNREAATAADVVELIDWYRARWEIETFFH 306 Aromatoleum aro...
WP_020935938 283 LSIATGTCELRAPRNnp----eqEGSIEANVVRVDEvG--EnDDPIQWVLLTTESVEEFEETLTLIDYYGLRWRIEDWHK 356 Halorhabdus tia...
WP_010947782 361 ILKSGFKVEECRLGAADRLVRFLTIMSVIAWRIFFITLVARESPDLPCS---------------FLLANEEWNVLyTKIH 425 Legionella
WP_000633033 331 AWKTGAGAERQRMEEPDNLERMVSILSFVAVRLLQLRESFTLPQALRAQgllkeaehvesqsaeTVLTPDECQLLgYLDK 410 Proteobacteria
WP_010947831 340 AWKSGVGAEEQRMQSIENLEKMIVILSFVAIRLLQLKEYFEYPTTLVINdsst--------scdELLTDAKWKVL-WNSV 410 Legionella pneu...
WP_011140150 332 ILKSGCAVEQLQLETAQRLERALAVYCIVAWRLLQLTYQSRSEPELPCT---------------VALAQHEWQALyCRMT 396 Gloeobacter vio...
WP_076611285 339 ALKSGCGLEKLQLETGRRIEMALATYSIVAWRLLWLTYQARLHGEESCE---------------SFLEEHEWQSLcATIH 403 Microcystis aer...
WP_076612417 344 ILKSGLKVEECRLGTAERLMRYLTVMSIIAWRIFFITTIARIDPTLPCT---------------TLLAEEEWKVLyVKIH 408 Legionella
WP_010946384 345 ILKSGCKIEELRFETYEATLNCIAFYMIVAWRVFYLTMLGRTCPDIDCT---------------TVFEDNEWQATyAMAT 409 Legionella pneu...
WP_012701870 333 VLKNGCQINCLQLETEERLLPCIGLYLVVAWRVLYSLMLGRACPELNCE---------------LIFEAREWRAAyLVIK 397 Azotobacter vin...
WP_011235908 307 VLKNGCRIEALQLSAIERLERALALFMVVAWRIAHLMRTGRTCPELDAT---------------LFFDPDEIRGAyLLTK 371 Aromatoleum aro...
WP_020935938 357 VLKSGCNIEERQLQTWERMEVLLSMYSVIAWKVLELRELARGDSSVSPA---------------VLLSEAECTILeTKFP 421 Halorhabdus tia...
WP_010947782 426 HTKHYPETPPTIKEAVKWIAQLGGFLARKNDGEPGPITLWRGWKRLVDLAEGW 478 Legionella
WP_000633033 411 GKRKRKEKAGSLQWAYMAIARLGGFMDSKRTGIASWGALWEGWEALQSKLDGF 463 Proteobacteria
WP_010947831 411 ERKSLPEKIPTAAWAYKAIAKLGGWTDSKRTGKAAWSTIWKGWFRLQERVEGL 463 Legionella pneumophila
WP_011140150 397 QSRQLPEEAPSLRQAVRWIAQLGGFVGRKGDGEPGVKTLWRGWQRLEDLAAGW 449 Gloeobacter violaceus
WP_076611285 404 KKSPPPEKPPSFREAVRMIASLGGFLGRKGDGEPGVKTIWLGLRRLHDISQTW 456 Microcystis aeruginosa
WP_076612417 409 R-KPCSNATPTIKEAVSWIAQLGGHLARKNDLEPGPITIWKGWRRLFDLAEGW 460 Legionella
WP_010946384 410 KKKPPKK-PPKLYEIILMIAKFGGHLGRGSDGLPGTKVMWIGLQRMKDFTLAW 461 Legionella pneumophila
WP_012701870 398 RCPPPPV-PPRLGEMVEWVAGLGGYLGRKHDGPPGPKAMWIGLQRLREFVIAL 449 Azotobacter vinelandii
WP_011235908 372 K-KPPAT-PPTINEVLRLIATLGGFLARKGDGEPGVKTIWLGLQRVMDAAATI 422 Aromatoleum aromaticum
WP_020935938 422 ELSDQDG-----KSYAVSVAKLGGYLDRGSDPPPGWETMWKGLQKLRMWAEGY 469 Halorhabdus tiamatea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap