Conserved Protein Domain Family
transpos_ISC774

?
NF033588: transpos_ISC774 
IS6 family transposase
ISC774 is an example of an outlier clade of IS6 family insertion sequences. Members so are appear restricted to the archaeal genus Sulfolobus.
Statistics
?
PSSM-Id: 411210
Aligned: 5 rows
Threshold Bit Score: 263.621
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_010978853  15 VILILMEYINLEPRFYSSEVVALALASYLSGLSSWR----TCLPHSTLLYYLRRLSCVRYVVPVSGFYAVDETKIMVVKG 90  Sulfurisphaera ...
WP_011182870  13 VMIYLLQLNNLKPRFWSLQELAEALASYFLGLSLRR----FRVPRSTVHYYWRRATRTTLDLPLTGEYAVDETKVLLVKG 88  Sulfolobus teng...
WP_076611426  14 MLSSVFSALNLSPRFHTIDEVAKALSAYYLGLSLRRvealFHVPRNTVQYYWRKLANYSSPPSCSGYYAVDETRIRVVNG 93  Sulfolobus isla...
WP_076611427  14 VLSSVFSVLNNFPRFPGSESNARTLSAYYLGLSLRRvedlFHVPKNTVQYYWRKLANYFSPPSCSGHYAVDETKIRVVNG 93  Sulfolobus
WP_076611319  30 VILTLMEYINLKPRFHVREEIALSLASYLADLSSWR----TTLFHFTLLY--ERLGSLRYAVSLS--YAIDETKVTCVRG 101 Saccharolobus s...
WP_010978853  91 QYYYVWIVRDVKTGAIPFFMVTSSRSGLHVLVVLTnmKnvEKEAEKVlktridkVVYIHDGATVYNAFTWLNVE-HKRVT 169 Sulfurisphaera ...
WP_011182870  89 VMYYLWVVRDVNTGVIPFFMITKARSGLDVIILVK--R--VRQVEIRtrgeflrAKYIHDGLPAYNFLSIAGVD-HEHVT 163 Sulfolobus teng...
WP_076611426  94 LLYWLWVVRDLNTGKVVAVRLSETRSGLDVILLLEggG--IRVEEVR--------EILHDGGPWYNILSTLGVNpHEHET 163 Sulfolobus isla...
WP_076611427  94 LLYWLWVVRDLNTGKVIAVRLSKTRSGLDVILLFKgkR--IRLEKTI--------NILPDGGPWYNKLSTLGVK-HEHVT 162 Sulfolobus
WP_076611319 102 N-YYVWVIREVVAKAISFFMVTSLRSGFHVVIM-RglR--VSTLENR-------VVYLHDGLSVYNAFDWFNVG-HKRVT 169 Saccharolobus s...
WP_010978853 170 FNERDYAEQGFRSLKHRISSMDFHFPWNTNRFTLTRWLSVFFLAYNALY 218 Sulfurisphaera tokodaii
WP_011182870 164 FGIRNRVEQVFRTAKHRLSTMDFHFPWNASKRSLESWFSAFFTVYNLLE 212 Sulfolobus tengchongensis
WP_076611426 164 FGKRNLVEQMFRSLKLRLASMDKHFPHNASKATILRWVKAFFTLYNLLQ 212 Sulfolobus islandicus
WP_076611427 163 FGKKNLVEQVVRSLKLRLANMDKHFPPNASKGSIIRWGKAFFTLFNLFQ 211 Sulfolobus
WP_076611319 170 LG--DYTEEGSRKLKHRVSSMDF----ACNSNKLMSWFSTFFLIYNLLY 212 Saccharolobus solfataricus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap