Conserved Protein Domain Family
staphy_B_SbnF

?
NF033586: staphy_B_SbnF 
staphyloferrin B biosynthesis protein SbnF
Statistics
?
PSSM-Id: 411208
Aligned: 7 rows
Threshold Bit Score: 1066.33
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_019166232   3 QLIEQVRQRIMQQLVTSLIYEDVVRYeQLPPDDdECETFVIEGEVATYRVRVQQSDSFERLRIISPVWRIADGEEAV-TL 81  Staphylococcus ...
WP_001794515  28 TILNRVKTRVMYQLVSSLIYENIVVY-KASYQD-GVGYFTIEGNDSEYRFTAEKTHSFDRIRITSPIERVVGDEADT-TT 104 Staphylococcus
WP_001066357   8 VILDRVKTRVMQQLVSSLIYENIVVY-KESYRE-AVHHFTIEGNGSEYHFTAKNAHSFDRICLTSPVTRIVGNDITE-TT 84  Staphylococcus ...
WP_019168768   3 HLIEQVRRRIMQQLVTSLIYEDVVRYdRKALDDeGCYTYEIEGEAATYRVQVQQSDSFERLTLISQVWRIVGEDEVE-TL 81  Staphylococcus ...
WP_016425804   3 SIVQKVRTRIMNQLITSLIYEDVVQYdVVSFKD--YNRYTLKGTDVSYQVDIQASLSFGRLTVVSPVWLRDADGQTE-TL 79  Staphylococcaceae
WP_002511707   3 NIEQQVKQRIMNQLVTSIIYEDVVQY-EVTQQG-ATSIVTIEAEDATYRAEVRELDSFQRLELTSPVWRITDDGDTAvTV 80  Staphylococcus ...
WP_002510736   4 NTEQLVKQRIMNQLVTSLIYENIVHY-QVSQND-QKETVIIAAGDATYHVTVHEAFSFQRLTLQSSVLRCNAKGKYEaTV 81  Staphylococcus ...
WP_019166232  82 DYAQLLREVRFTFDKDEQKLEDFIIELLQTELKDTQAQRYRAQQSQMPLTTFDDYEAYAMEGHMYHPSYKSRLGFTLDDN 161 Staphylococcus ...
WP_001794515 105 DYTQLLREVVFTFPKNDEKLEQFIVELLQTELKDTQSMQYRESNPPATPETFNDYEFYAMEGHQYHPSYKSRLGFTLSDN 184 Staphylococcus
WP_001066357  85 DYAQLLREALFTFPKDDEKLEQFIIELLQTELKDTQSLHFREEHPPAKPKTFNDFEFYAMEGHRYHPSYKSRLGFTLSDN 164 Staphylococcus ...
WP_019168768  82 NYVQLLRDVHFTFEKDEQKLEDFIIELLQTELKDTQARRYRAQQSDIALTTFDDYESYAMEGHMYHPSYKSRLGFTLTDN 161 Staphylococcus ...
WP_016425804  80 DYVTLLRTVDFTFEKDEAKLEHFIIELLQTELKDIQAWRYRMAHPVEKLVTYDDYEAYAMDGHMYHPSYKSRLGFSLEDN 159 Staphylococcaceae
WP_002511707  81 DYATMLREVIYTFEKNNEKVETFINELLQTELKDTQAMRYKEMTAGSVKLTFDALESYAMEGHPYHPSYKSRLGFTLVDN 160 Staphylococcus ...
WP_002510736  82 NYAQLLREVEYTFPKNTEKIEAFIQELLQTELKDRQALQYKEGSKESITLTFDALESYASEGHPYHPSYKSRLGFTLEDN 161 Staphylococcus ...
WP_019166232 162 ARYGPDFRPSFQLQWIAIAPDHVETTVSASVDTVALLQRQLGAETLAAFEKTLQQHGHTLETMVLIPVHPWQFEHIIQVE 241 Staphylococcus ...
WP_001794515 185 LKFGPDFVPNVKLQWLAIDKDKVETTVSRNVVVNEMLRQQVGDKTYEHFVQQIEASGKHVNDVEMIPVHPWQFEHVIQVD 264 Staphylococcus
WP_001066357 165 LNYGPDFVPEIKLQWLAIDKDKVESTVSQNIAVNDLLRQQLGDATYQCFVDEIEKSGKGIEDVEIIPVHPWQFEHVIQVE 244 Staphylococcus ...
WP_019168768 162 ERYGPDFRPSFQLQWIAIAPDYVETTVSHSVDTVALLKRQLGSATLAAFEETLQQHGHSLETMVLIPVHPWQFEHIIQVE 241 Staphylococcus ...
WP_016425804 160 ETYGPDFRPTFQLHWVAVDKHNIEETVSQSIEVSQLLQTQLGSDTYAKFVETIQSHGKDVDDVAILPVHPWQFERVIEVE 239 Staphylococcaceae
WP_002511707 161 LQYGPDFQPTFTLKWLAIPKQYIEQTVSRNIESQDLLQQQLGDEVVQHFKEVLLALDKSLADYEWLPVHPWQFDHIIANE 240 Staphylococcus ...
WP_002510736 162 LRYGPDFKPEFTIKWLAIPQQHIERTLATGIEPEQLLAQQLDATTYRQFQQTISAQGDETIDYVWLPVHPWQFDHIVATD 241 Staphylococcus ...
WP_019166232 242 FAEAWMHGELLWLGTSDEMYVPQQSIRTLTPTDRNKYYLKTPISITNTSTKRVLAPHTIENAAQITDWLKRIQSKDTYLQ 321 Staphylococcus ...
WP_001794515 265 LAEERLNGTVLWLGESDELYHPQQSIRTMSPIDTTKYYLKVPISITNTSTKRVLAPHTIENAAQITDWLKQIQQQDTYLK 344 Staphylococcus
WP_001066357 245 LAEEWLNGTVLWLGESDEVYHPQQSIRTMSPTDTSKYYLKVPISITNTSTKRVLAPHTIENAAQITDWLKHIQQKDTYLS 324 Staphylococcus ...
WP_019168768 242 FAEAWMLGEMLWLGTCDEMYVPQQSIRTLTPTNRDKYYLKTPISITNTSTKRVLAPHTIENAAQITDWLKHIQSEDTYLQ 321 Staphylococcus ...
WP_016425804 240 FAEAKWQGELLYLGMSEEKYTPQQSIRTLTPQQPERYYLKVPMSLTNTSTKRVLAPHTIENAAQITDWIKKIQAHDVYLT 319 Staphylococcaceae
WP_002511707 241 LAEQWINGEIILLGESEEYYTPQQSIRTLSPVDTSKYYIKVPLSITNTSTKRVLAPHTIENAAQITDWLKHIHEQDSYLN 320 Staphylococcus ...
WP_002510736 242 LAEEWLNGDIIYLGESLETYRPQQSIRTLAPVDTTKYYIKVPLSITNTSTKRILAPHTIGNAAQITDWLKQIQAVDSYLQ 321 Staphylococcus ...
WP_019166232 322 QELKTVFLGEVLGHAYHNTTLSEVKQQRIYGALGVIWRENIHHYLASHESAMPFNALYSVDADTRPLIDAWMSKYGAEQW 401 Staphylococcus ...
WP_001794515 345 DELKTAFLGEVLGQSYLNTQLSPYKQTQVYGALGVIWRENIYHMLIDEEDAIPFNALYASDKDGVPFIENWIKQYGSEAW 424 Staphylococcus
WP_001066357 325 DDLKTVFLGEVLGQSYLNTQLSSYKQTEIYGALGVIWRENIYHMLNDEEEAIPFNALYASDKDDVPLIESWIKSYGAEAW 404 Staphylococcus ...
WP_019168768 322 HDLKTIFLGEVLGHAYHNPTLSEAKQQRIYGALGVIWRENLHHYLAPNESAIPFNALYSMGADSRPLIDAWMTKYGTQQW 401 Staphylococcus ...
WP_016425804 320 ETLKTVFLGEVLGQAYLNKQATETKQAHVYGALGVIWRENIHNYLGSKESAIPFNALYVLDAQQQPLIQAWIAQYGLEAW 399 Staphylococcaceae
WP_002511707 321 KELKTVFLGEILGMSYINDNLTESKREAIYGAVSVIWRENLHSYLTETEDAIPFNAIYSLDQRQNPIIQQWIAQYGVAAW 400 Staphylococcus ...
WP_002510736 322 DDLQTIFLGEIMGMSYQSPTANTAKQQATYGALAVIWRENLHHYLSAQEDAIPFNALYSKEKNGRPLIDEWMQRYGIATW 401 Staphylococcus ...
WP_019166232 402 MAQFFSVAVTPLIHMLYNHGIAFESHAQNMMLIHENGWPTRIALKDFHDGVRFKPSLLSEIAQNPQLRDTPEAHRKVNRN 481 Staphylococcus ...
WP_001794515 425 TKQFLAVAIRPMIHMLYYHGIAFESHAQNMMLIHENGWPTRIALKDFHDGVRFKREHLSEAASHLTLKPMPEAHKKVNSN 504 Staphylococcus
WP_001066357 405 MKQFLSVAVRPMIHMLYYHGIAFESHAQNMMLIHKNGWPTRIALKDFHDGVRFKREHLSETASHLKLKPMPEAHKKVNSN 484 Staphylococcus ...
WP_019168768 402 MAQFLTVAVTPMIHMLYYHGIAFESHAQNMMLIHEEGWPTRIALKDFHDGIRFKPSLLSEIAQNPQLRETPEAHRKVNQN 481 Staphylococcus ...
WP_016425804 400 LEQFFKVAIEPMIHMLYYHGIAFESHAQNMMLIHEDGWPTRIALKDFHDGVRFKRALLSDIAQDPKLKEMPESHKKINSN 479 Staphylococcaceae
WP_002511707 401 VRQFIKVAVQPIIHMLYYHGIALESHAQNMMFIHEDGWPTRVAIKDFHDGVRFKRGLLSTEAQNPQLKDTPEKHKKINRN 480 Staphylococcus ...
WP_002510736 402 TQQFIKVAVQPIIHMLYYHGIALESHAQNMMLIHEDGWPTRVAIKDFHDGIRFKRDLLSDMASDPQLQDTPEEHKKINSN 481 Staphylococcus ...
WP_019166232 482 SFIETDDVDLVRDFLHDAFFFINIAEIIDFVARQYELKASEQWAMVRTVIEQYQQQFPGLENYRHFDLFVPTIQVEKLTT 561 Staphylococcus ...
WP_001794515 505 SFIETDDERLVRDFLHDAFFFINIAEIILFIEKQYGIDEKLQWKWVKGIIEAYQEAFPELNNYQHFDLFEPTIQVEKLTT 584 Staphylococcus
WP_001066357 485 SFIETDDERLVRDFLHDAFFFINIAEIILFIEKQYGIDENLQWQWVKAIIDSYQEAFPELNNYQHFDLFEPTIQVEKLTT 564 Staphylococcus ...
WP_019168768 482 SFIETEDVALVRDFLHDAFFFINIAEIIDFVARQYEMKASEQWEIVRAVISQYQQTFPDLPNYRQFDLFVPTIQVEKLTT 561 Staphylococcus ...
WP_016425804 480 SFIETEDEALVRDFLHDAFFFINIAEIARFINAQYQLEERKQWEMIAQVIKTYQNRFPNLQNYAHFDLFEPTIQVEKLTT 559 Staphylococcaceae
WP_002511707 481 SFIETEDVELVRDFALDAFFFINISEIIMFFERHYNLSERQQWMYVYDEIKQYRQTHPDLPNYEHFDLFEKTIQVEKLTT 560 Staphylococcus ...
WP_002510736 482 SFIETENVALVRDFVLDAFFFINISEIIMFIEAHYALDQRSQWEYVYAELEAYRRKYPNLANYAHFDLCESTIQVEKLTT 561 Staphylococcus ...
WP_019166232 562 RRLREDVALRLHEVRNPLRR 581 Staphylococcus delphini
WP_001794515 585 RRLLSDSELRIHHVTNPLGV 604 Staphylococcus
WP_001066357 565 RRLLNDSELRIHHVTNPLGI 584 Staphylococcus argenteus
WP_019168768 562 RRLREDVALRLHEVSNPLRR 581 Staphylococcus intermedius
WP_016425804 560 RRLRDDSEMRVHHVNNPLGG 579 Staphylococcaceae
WP_002511707 561 RRLLEDTEIRIHHVSNPLGE 580 Staphylococcus equorum
WP_002510736 562 RRLLEDTELRIHHVSNPLGV 581 Staphylococcus arlettae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap