Conserved Protein Domain Family
staphy_B_SbnC

?
NF033583: staphy_B_SbnC 
staphyloferrin B biosynthesis protein SbnC
SbnC, related to siderophore biosynthesis protein IucA and IucC, is encoded in Staphylococcus aureus in the sbnABCDEFGHI locus responsible for the biosynthesis of staphyloferrin B, a carboxylate-type siderophore. SbnC is found in many species of Staphylococcus.
Statistics
?
PSSM-Id: 411207
Aligned: 13 rows
Threshold Bit Score: 1006.54
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_050344963   5 KIRNNEALAQQTILKDLVDALLFEDIGGLASKSEVVMHGHQLFLHYGTTERYLSIPVYMSGLNLFRYAPSA-VLLCQHGQ 83  Staphylococcus
WP_099987398   4 EHEHNVTRAQQYILKDLVDALLFEDLGGIASTSERLTIQQQTYLRYEKKGIVLLIPVYYSGLNVYRSNGEA-VFHIESKT 82  Staphylococcus ...
WP_096555204   4 EHEHNVTRAQQYILKDLVDALLFEDLGGIASTSERLTIQQQTYLRYEKKGIVLLIPVYFSGLNVYRFNGEA-VFHIESKT 82  Staphylococcus ...
WP_086428376   4 EHEHNVTRAQQYILQDLVDALLLEDLGGIASTSHRLSIQQQQYLRYEKKGIVLLIPVYFSSLNVYRFNGEA-VFRIESKT 82  Staphylococcus ...
WP_085237652   4 YEESFKQRAHRHILKDLVDALIFEDIGGIVSASQSMRLGQQCYLRYEKQDTVLLIPVYQSGLNMYRFNGDA-VECVEAEV 82  Staphylococcus ...
WP_078377630   2 HTHKAVNTAQTIILRDLVDALLFEDIAGIVSNSEITKEHGQTILIYKNGDQQIKIPVYFSALNMFRYESSK-PITIDGKS 80  Staphylococcus ...
WP_001179401   2 QNHTAVNTAQTIILRDLVDALLFEDIAGIVSNSEITKENGQTILIYKRETQQIKIPVYFSALNMFRYESSQ-PITIEGRL 80  Staphylococcus ...
CDR23051       2 HTHKAMNTAQTIILRDLVDALLFEDIAGIVSNSEITKEHGQRILIYKNENQQIKIPVYFSALNMFRYESSK-PITIDGRA 80  Staphylococcus ...
WP_039643502   4 VANYDEQLASKVILSDLIDALFFEDVFELYSKGRVIHQDEQTLFVYQHEDQRLEIPVYLSSLNVYRFARSQgEVKLYTLH 83  Staphylococcus ...
WP_069802656   5 TANHQQNHAHTTILRDLVDGLLFEDVFGLLTKSEALQIASDTILKYGNEDKALYIPVYHSGLNIYRLKGTT--VFVKDND 82  Staphylococcus ...
WP_065339030   5 TANHQQNHAYTTILKDLVDGLLFEDVFGLLTKSEALQIASDTILKYGNEDKALYIPVYHSGLNIYRLEGMT--VFVKEND 82  Staphylococcus ...
WP_069816858   5 TANHQQNHAHTTVLRDLVDGLLFEDVFGLLTKSEALQIASDTLLKYSNEDKALYIPVYHSGLNIYRLKGTT--VFVKDND 82  Staphylococcus ...
WP_103388287   5 TAQLQQQKAQLHILRDLVDSMLCEDIFELWSKSRLEQTPTATILHYQQAAQTLSIPVYLSGLNTYRLASDT--VVLHSKT 82  Staphylococcus ...
WP_050344963  84 EK-TLHAVELWEQIVEMNPSEAEAWEWRRFRQGLQDAVQQLTGQLKGMNLSDHPFIRAEQLASFKDRPFHPIAKEKRGFR 162 Staphylococcus
WP_099987398  83 CM-PLTVHELWELFVTMNADLAAEWAHARFAEGLEAAVTELTAQYDGFKASEHPFILSEQFASLKDRPFHPVAKEKRGLT 161 Staphylococcus ...
WP_096555204  83 CM-PLTVHELWELFVAMNADLATEWAHARFAEGLEVAVNELTAQYDGFKASEQPFILSEQLASLKDRPFHPVAKEKRGLS 161 Staphylococcus ...
WP_086428376  83 CM-PLTVRELWELFVTMNADLATEWAHERFAEGLETAVAQLTAQFNGFKASEHPFIFSEQLASLKDRPFHPVAKEKRGLT 161 Staphylococcus ...
WP_085237652  83 CR-PLQAVAFWQQFITMNADIATEWEHQRVTAGLAVAIEQLTDQYVHFSPSEDTFIYSEQLASLKDRPFHPLAKEKRGLT 161 Staphylococcus ...
WP_078377630  81 SSkQLTAPEFWRMIVNMNRDLSHEWEVARVEEGLNTAITQLAKQLSELDLATHPFVMSEQFASLKDRPFHPLAKEKRGLS 160 Staphylococcus ...
WP_001179401  81 SKqPLTAAEFWQTIVKMNRDLSHEWEVARVEEGLTTAATQLAKQLSELDLASHPFVMSEQFASLKDRPFHPLAKEKRGLR 160 Staphylococcus ...
CDR23051      81 SKqPLTAAEFWQTIANMNCDLSQEWEVSRVEEGLTTAATQLAKQLSELDLASHPFVMSEQFASLKDRPFHPLAKEKRGLS 160 Staphylococcus ...
WP_039643502  84 KTiTLNAVSLWDTLVMMHPDEAKQLNSVRFREGLVQACQQLAAQYQGLDLAEHPFVQSEQFASLKDRPFHPLAKEKRGLN 163 Staphylococcus ...
WP_069802656  83 EQhEINALGLWDALVEMNAPSSSELNTVRFREGLEVAMDQLTAQLAGLTLSEHPFIKSEQFASLKDRPFHPLAKEKRGLG 162 Staphylococcus ...
WP_065339030  83 EQhEINALRLWDTLVEMNASSSRELNIERFREGLEVAMDQLTTQLAGLTLSEHPFIKSEQFASLKDRPFHPLAKEKRGLD 162 Staphylococcus ...
WP_069816858  83 EEhEINALALWDTLVEMNAPSSRELNTARFREGLEVAMDQLTAQLEGLTLSEHPFIKSEQFASLKDRPFHPLAKEKRGLD 162 Staphylococcus ...
WP_103388287  83 AQhIADAVTLWQALVSMNAARCDNLNVQRFAEGLMTAEQQLADQLTHLTLADNTFIQAEQLASLKDRPFHPLAKEKRGLS 162 Staphylococcus ...
WP_050344963 163 VSDYEKYQSEFHQPIALNTVAVHKDFVLNGQKADAQRYQDYFGATLDPCK-AELQARGLLETAYMIFPVHPWQYEHVLPV 241 Staphylococcus
WP_099987398 162 AEDYAVYQAEYHQPLAVQTVAIRKSHVIQGKGATDEQYAQFWGDTLVRCQ-QALIEKGYDTEDYVIFPVHPWQYEHVLPV 240 Staphylococcus ...
WP_096555204 162 AEDYAVYQAEYHQPLAVQTVAIRKSHVIQGKGVTDEQYAQFWGDTLLRCQ-QALIEKGYDTADYVIFPVHPWQYEHVLPV 240 Staphylococcus ...
WP_086428376 162 AEDYTLYQAEYHQPLAVKTVAIKKSHLLQGEGVTDERYTSFWGDTLVRCQ-QALIEKGYDAADYIIFPVHPWQYEHVLPT 240 Staphylococcus ...
WP_085237652 162 PEDYQCYQSEYYRPFAVRTVAVKKTHVLHSATATTQCYETFWGTALEESR-QVLSARGYDAEAYLIFPVHPWQYAHVIPQ 240 Staphylococcus ...
WP_078377630 161 ETDYQVYQAELNQSFPLMVAAVKKTHMIHGDEADYDELESLTAPIKDQAT-DLLNNKGLSIDDYVLFPVHPWQYQHILPN 239 Staphylococcus ...
WP_001179401 161 EADYQVYQAELNQSFPLMVAAVKKTHMIHGDTANIDELESLTAPIKEQAT-DMLNDQGLSIDDYVLFPVHPWQYQHILPN 239 Staphylococcus ...
CDR23051     161 EADYQAYQAELNRSFPLMVAAVKKTHMIHGDTANIDELERLTTPIKEQAT-DMLNDQGLSIDDYVLFPVHPWQYQHILPN 239 Staphylococcus ...
WP_039643502 164 ASDYAHFQAEYNEPMSLKVVALHRNWVMASQHANEATLQCALNITTDNTFhQYMEAQGLNPENYMLFPVHPWQFNHVLPH 243 Staphylococcus ...
WP_069802656 163 KSDYQQYQPEYFKTFSLKTVAIHRDYILKSEYLNESLLNKALAIEDEDILaHTLESAGLSSESYMVFPVHPWQMTHVIPE 242 Staphylococcus ...
WP_065339030 163 TEDYQHYQPEYFKTFSLKTVAIHRDYILRSEYLNESLLNEVLAIEDEDILaDTLESAGLDSESYMVFPVHPWQMTHMIPE 242 Staphylococcus ...
WP_069816858 163 TADYQQYQPEYFRTFSLKTVAIHRDYILKSEYLNESLLNEALAIEDEGTLaHTLEAAGLSSE-YMVFPVHPWQMIHVIPE 241 Staphylococcus ...
WP_103388287 163 ETDYKRYQAEYCQSFALQTVAIHRDYLIAGDVAEEAALMETLGLTDIQVK-QLLREHEVTAADYMVFPVHPWQWEHIIRP 241 Staphylococcus ...
WP_050344963 242 EFEAEIEAQQVVRLKHTFGRYLSSSSMRTLINLEQPFEHLKVPLSIQSLGALRLTPTRYMKNGEVAEQLLHTLIQQDERL 321 Staphylococcus
WP_099987398 241 QFSAEIKQGIVVLLDVTMGQYLSSSSMRTLIPLAAPFTHLKVPFSMQSLGALRLTPTRYMKNGEAGETLLRDIIAQDTSL 320 Staphylococcus ...
WP_096555204 241 QFSAEIEQGIVVLLDVTMGQYLSSSSMRTLIPLGAPFAHLKVPFSMQSLGALRLTPTRYMKNGEAGEALLRDIIAQDASL 320 Staphylococcus ...
WP_086428376 241 QFSSEIQQGIVVMLDVTMGQYLSSSSMRTLIPLDQPFTHLKVPFSMQSLGALRLTPTRYMKNGEAGEALLRHIIAQDASL 320 Staphylococcus ...
WP_085237652 241 QFESEIEQGIVVLLDMHVGAYVSSSSMRTLLPTEPSMVHLKVPFSMQSLGALRLTPTRYMKNGEAGEGLLREITARDTLL 320 Staphylococcus ...
WP_078377630 240 IFAKEIAEKLVVLLPLKFGDYLSSSSMRSLIDVASPYNHVKVPFAMQSLGALRLTPTRYMKNGEQAERLLRQLINKDEVL 319 Staphylococcus ...
WP_001179401 240 VFAKEISEKLVVLLPLKFGDYLSSSSMRSLIDIGAPYNHVKVPFAMQSLGALRLTPTRYMKNGEQAEQLLRQLIEKDETL 319 Staphylococcus ...
CDR23051     240 VFAKEIAEKLVVLLPLRFGDYLSSSSMRSLIDVASPYNHVKVPFAMQSLGALRLTPTRYMKNGEQAERLLRQLIEKDEVL 319 Staphylococcus ...
WP_039643502 244 YFEQEIKEKVIVPLDMKCGRFVSSSSMRTLIDIERPFDHIKVPFAMQSLGALRLTPTRYLLNGEQGEALLEQVRQQSEYL 323 Staphylococcus ...
WP_069802656 243 MFQAEIAARIIVPLDYEFGEFLPSSSMRSLIDIQRPFQHIKVPFSMQSLGALRLTPTRYLLNGEKAEQLLSEIIAQDSTL 322 Staphylococcus ...
WP_065339030 243 MFQAEIAARIIVPLDYEFGEFLPSSSMRSLIDIQRPFQHIKVPFSMQSLGALRLTPTRYLLNGEKAEQLLSEIIAQDSTL 322 Staphylococcus ...
WP_069816858 242 MFQAEIAAHIIVPLDYEFGAFLPSSSMRSLIDIHRPFQHIKVPFSMQSLGALRLTPTRYLLNGEKAEQLLSEIIAQDSTL 321 Staphylococcus ...
WP_103388287 242 MFQGELATGVIVPLNYKFGNYVSSSSIRSLIDVQDPFHHLKVPFAMQSLGALRLTPTRYLLNGEKAEGLLRQVIAQDKNL 321 Staphylococcus ...
WP_050344963 322 KGHVWPCDETAWWSYLSADGDVFKDQLGHLTMQFRQYPEAIKKdvGQQLVSMAALAAHDDSLYRMILSQPHGslTQAQIT 401 Staphylococcus
WP_099987398 321 NGRVKLCDETVWWSYMNEAQDIFQDQSGHLTMQLRHYPESIKD--AQMVTSMAALAAHESTLYERILETDHP--TTEQIN 396 Staphylococcus ...
WP_096555204 321 NGRVKLCDETVWWSYMNEAQDIFQDQSGHLTMQLRYYPESVKD--AQMVTSMAALAAHESTLYERILETDHP--TPEQIH 396 Staphylococcus ...
WP_086428376 321 HGRVALCDETVWWSYMNEAQDIFQDQSGHLTMQLRHYPQSAEE--ADWVVSMAALAAHEPTLYQQILDTTEP--TTEQIA 396 Staphylococcus ...
WP_085237652 321 HESVQLCDETVWWSFINEKRDIFQDQSGHLTMQFRYYPESMAD--NTIVVSMAALAAHDRGLYQRILGTPEP--TTSQLL 396 Staphylococcus ...
WP_078377630 320 AKYVTVCDETAWWSYMGQDNDVFKDQLGHLTVQLRKYPEVLAQndEQQLVSMAALAANDRTLYQMICGKDNLs--QNDIM 397 Staphylococcus ...
WP_001179401 320 AKYVMVCDETAWWSYMGQDNDIFKDQLGHLTVQLRKYPEVLAKndTQQLVSMAALAANDRTLYQMICGKDNIs--KNDVM 397 Staphylococcus ...
CDR23051     320 AKYVTVCDETAWWSYMGQDNDIFKDQLGHLTVQLRKYPESLANnnAQQLVSMAALAANDRTLYQMICGKDNLs--KNDIM 397 Staphylococcus ...
WP_039643502 324 KTHLLLCDEKQWWSFIAPSKNIFEDRTGHLTVQLRQYPEVVKEt-DTVVISMAALAMADTRVLEPVFG--HCdfTSEEVE 400 Staphylococcus ...
WP_069802656 323 ENKVALCNEKQWLSFINADKDIFQDQIGHLTTQIRSYPKQVTAp-SSQLVSMAALAAHDDTLYEDILGIAQDqmESQQLE 401 Staphylococcus ...
WP_065339030 323 ENKVALCNEKQWLSFINADKDIFQDQIGHLTTQIRSYPKQVTAs-SSQLVSMAALAAHDATLYEDILGIDKAqmESQQLE 401 Staphylococcus ...
WP_069816858 322 ENKVALCNEKQWLSFINADKDIFQDQIGHLTTQIRSYPNQVTAs-SSQLVSMAALAAHDATLYEDILGIAQAqmESQQLE 400 Staphylococcus ...
WP_103388287 322 ADTVTLCNERQWWSFMQADGDIFADKIGHLTAQLRSYPESVMAd-HTQLVSMAALAVHDTKLYALIIDKPVKeiTQDDVL 400 Staphylococcus ...
WP_050344963 402 DLFEAITSSFLEMTCSFMKSGALPELHGQNVLIAFKDGKVSSFVLRDHDTVRIYPKWLKQQHIEVPQYTVRNDTPNTLIN 481 Staphylococcus
WP_099987398 397 ALFEQVSDAFLKMTLALMKYGVLPELHGQNVLVVFREGHVAEFVLRDHDTVRIFPEWLTAQGFKLPNYAVRKDTPNTLLN 476 Staphylococcus ...
WP_096555204 397 ALFEQVSDAFLQMTLALMKYGVLPELHGQNVLIVFREGRVAEFVLRDHDTVRIFPEWLTAQGFELPNYAVRKDTPNTLLN 476 Staphylococcus ...
WP_086428376 397 ALFEQVSDAFLKMTLSLMKYGVLPELHGQNVLIAFREGQVSEFILRDHDTVRIFPQWLTAQGFELPNYAVRKDTPNTLLN 476 Staphylococcus ...
WP_085237652 397 HLFEQLSLQFLKMALGFIKYGVLPEIHGQNVLVSFRDGQVTHFILRDHDTVRIFPKWLEKNGLEQPKYIVRKDTPNTLLN 476 Staphylococcus ...
WP_078377630 398 TLFEDIAQVFLKVTLSFMQYGALPELHGQNILLSFEEGHVQKCVLRDHDTVRIYKPWLTAHQLSLPQYVVREDTPNTLIN 477 Staphylococcus ...
WP_001179401 398 TLFEDIAQVFLKVTLSFMQYGALPELHGQNILLSFEDGRVQKCVLRDHDTVRIYKPWLTAHQLSLPKYVVREDTPNTLIN 477 Staphylococcus ...
CDR23051     398 TLFEDIAQVFLKVTLSFMQYGALPELHGQNILLSFEDGRVQKCVLRDHDTVRIYKPWLTSHQLCLPQYVVREDTPNTLIN 477 Staphylococcus ...
WP_039643502 401 AIYQDIVTSFIHTLFACMRRGILPEVHGQNVLVAFQNGRVRQFILRDHDTVRIYPTWMTLNGMDVPEYAIRKDTPNTLIN 480 Staphylococcus ...
WP_069802656 402 VLFDEMIDQFLHIMLKFMQNGVLPEVHGQNILILFKEGHVDQFILRDHDTVRIYPRWMYENNIDIPQYAISKNSPNTLIN 481 Staphylococcus ...
WP_065339030 402 VLFDEMIDQFLHIMIKFMKNGVLPEVHGQNILILFQEGHVDQFILRDHDTVRIYPRWMHENNINIPQYAISKNSPNTLIN 481 Staphylococcus ...
WP_069816858 401 VLFDEMVDYFLHIMLKFMKNGVLPEVHGQNILILFKEGHVDQFILRDHDTVRIYPQWMHENNIDMPQYAISKNSPNTLIN 480 Staphylococcus ...
WP_103388287 401 ALFDDIVAHFIQTVMTFMQYGVLPEVHGQNVLLSFQEGHVQQCVLRDHDTVRIYPPLMQANDINIPEYTISQNSPNTLIN 480 Staphylococcus ...
WP_050344963 482 ETLEDFFAYFQTLAVSVNLYAIIDALVQVFDIAEHDLMTILRNQLTYWVSTIEWLPEDKEKVEAILLEQQTWPFKRIILP 561 Staphylococcus
WP_099987398 477 EDIETFFAYFQTLAVSVNLYAIVDALVDVFKVSEMELMTQLRQTMQHHIDTIDWLPGTSEEVERIIFTQETWPFKRILLP 556 Staphylococcus ...
WP_096555204 477 EDIETFFAYFQTLAVSVNLYALVDALVDVFKVSETELMTQLRQTMQRHIDTIDWLSGTSEEVERIIFTHDTWPFKRILLP 556 Staphylococcus ...
WP_086428376 477 EDIETFFAYFQTLAVSVNLYAIVDALVDVFKVSEAELMTQLRQTMQRHIRTIDWLTDTSEEVEHIIFNHETWPFKRILLP 556 Staphylococcus ...
WP_085237652 477 KAIERFFAYFQTLAVSVNLYAIVDALVDVFNISEMTLMTLVRQKMHNAIGDIDWLPGQYEEVVRIIFQQETWPFKRILLP 556 Staphylococcus ...
WP_078377630 478 EDLETFFAYFQTLAVSVNLYAIIDALQDLFGVSEHDLMSLLKRILKNEVATISWVTADQLAVRHILFEKQTWPFKQILLP 557 Staphylococcus ...
WP_001179401 478 EDLETFFAYFQTLAVSVNLYAIIDAIQDLFGVSEHELMSLLKQILKNEVATISWVTTDQLAVRHILFDKQTWPFKQILLP 557 Staphylococcus ...
CDR23051     478 EDLETFFAYFQTLAVSVNLYAIIDMMQDLFDVSEHELMSLLKQILKNEVANISWVTADQLAVRHILFEKQTWPFKQILLP 557 Staphylococcus ...
WP_039643502 481 DDLETFFTYFQTLGILVNVYAIIDTFASLYQLDEQRLMAFLRQTMKQAVDETKWPNG-AAEVRQLLFDKETWPFKRILLP 559 Staphylococcus ...
WP_069802656 482 EDIETFFTYFQTLAVSVNLYAIVDMLHHVFGLDELMLMNKIKSSLSKHVQQMDCSEVDKAQVQHILFEKQMWPFKRVLLP 561 Staphylococcus ...
WP_065339030 482 EDIETFFTYFQTLAVSVNLYAIVDMLHHVFGLDELMLMNKIKSSLSKHVQQMDCSEVDKAQVQHILFEKQTWPFKRVLLP 561 Staphylococcus ...
WP_069816858 481 EDIETFFTYFQTLAVSVNLYAIVDMLHHVFGLDEIVLMNKIKSSLSKHVQQMDCSEADKAQVQHILFEKQTWPFKRVLLP 560 Staphylococcus ...
WP_103388287 481 DDLATFFTYFQTLGVSVNLYAIVDALHHTFNIKEAQLMTRIKHAMKQQVETLNFAPDTKQQITTLLFTADTWPFKRILLP 560 Staphylococcus ...
WP_050344963 562 LLLQKESGGGSMPSSLGRVPNPMMKHE 588 Staphylococcus
WP_099987398 557 LLHQRGDGGGSMPSSIGRVPNPMKRTD 583 Staphylococcus pseudintermedius
WP_096555204 557 LLHQRGDGGGSMPSSIGRVPNPMKWTD 583 Staphylococcus delphini
WP_086428376 557 LLHQRGDGGGSMPSSIGRVPNPMKWAD 583 Staphylococcus cornubiensis
WP_085237652 557 LLYQRSDGGGSMPSSLSRVPNPMKVTH 583 Staphylococcus lutrae
WP_078377630 558 LLYQRDSGGGSMPSGLTTVPNPMVTYD 584 Staphylococcus argenteus
WP_001179401 558 LLYQRDSGGGSMPSGLTTVPNPMVTYD 584 Staphylococcus aureus
CDR23051     558 LLYQRGSGGGSMPSGLTTVPNPMVTYD 584 Staphylococcus schweitzeri
WP_039643502 560 LLHQKDSGGGSMPSSIGEIVNPMMSYD 586 Staphylococcus hyicus
WP_069802656 562 LLHQQESGGGSMPSSIGTIPNPMMRHE 588 Staphylococcus equorum
WP_065339030 562 LLHQQESGGGSMPSSIGTIPNPMMRHE 588 Staphylococcus equorum
WP_069816858 561 LLHQQESGGGSMPSSIGTIPNPMMRHE 587 Staphylococcus equorum
WP_103388287 561 LLQQQGSGGGSMPSSIGTIANPMKRYD 587 Staphylococcus arlettae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap