Conserved Protein Domain Family
transpos_IS5_1

?
NF033578: transpos_IS5_1 
IS5 family transposase
Statistics
?
PSSM-Id: 411203
Aligned: 43 rows
Threshold Bit Score: 457.425
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012473948  10 TFENFHLPFGGKLDPQNRWVKLAELIPWHVAEKMYAMNFPSKRGAPALTVRMALGALIIKEKLGLSDIETVEQIKEGPYL 89  Chlorobium phae...
WP_011673997  10 SIEAFGEANGVKLSPDNRWVQAATLIPWPELEEAYKTVFPSNKGRAGKPFRLLFGAHLIKTREGLSDRELVDAIRDVPAY 89  Lacticaseibacil...
WP_041092043  11 SINSFETALGCPLSADNEWVQLANQLPWSEWDEVYQLAFPSNLGRAGKPFRQLYGAQLIKQRTGLSDREVVDAIRDTPAY 90  Paucilactobacil...
WP_003605947  11 SFQSFNNGLGVPLSSDNEWVQLADMLPWQQLDEAYQLLFTEMGGRAAKPFRLLYGASLIKQAEHLTDRSVVTAIRDTPAY 90  Lacticaseibacillus
WP_006856457  13 TLFDFNQSCGMELDPINEWIKLAHAIPWSKMEAKYVAMFPSKTGRPATPFRMALGVLIIQKRKKLSDRDVIKEIQENPYL 92  Roseburia intes...
WP_006907146  11 GRTDFNQPIGLKMNPENRWIKKAERIPWDEIEDRYASLFPSHTGMPAKPLRVALGSLLIQKQYSYSDRELVEQITENPYY 90  Shuttleworthia ...
WP_007277908  10 KMANLPYFLDGTLNINNRWVKLAAIIPWTDVEEIYALNFTSHTGPKALPARTAFGSLIIQVKLSLTDEETVEMISENPYL 89  Lentisphaera ar...
WP_012267176  11 PPENFELPFEGKLSQDNRWVIMANLIPWSEFEAEYASLFSEEMGAPAKTFRTALGALIIKEKLGTSDRETVEQIKENPYL 90  Microcystis
WP_008274984  11 TPEKFELLPGTKLSLENRWVIMAELIPWDEFEEEYAKQFKIEKGAPAKPFRMALGALIIKEQLGISDRETVEQIRENPYL 90  Crocosphaera ch...
WP_015957362  11 PPENFALPFEGKLSPNNRWVIMASLIPWEDFEEEYAKLFDSEKGAPAKPFRMALGTLIIKEKLGTSDRETIEQITENPYL 90  Rippkaea orient...
WP_012473948  90 QYFIGLESFQYEAPFDASMLTHFRKRLKHa--dLAALQEELLQRhlaeerkraEEKKENNDGDDdgnd-----gpanKGK 162 Chlorobium phae...
WP_011673997  90 QFFMGLPEYQPRRPFVPSAMAHFRKRIAP----IAELLENIIGD---------WTRKQLVGSVD-------------DKV 143 Lacticaseibacil...
WP_041092043  91 QYFLGFSEYQPVRPFDHVTLVYFRKRIAPisdqILNIMAKYTGK---------LLNEALPDKRV---------------- 145 Paucilactobacil...
WP_003605947  91 QYFIGLDTYTTDLPFNHSTLVYFRRRMGQitelVRNIISDTLR----------EQIQSLLPDDE-------------LRV 147 Lacticaseibacillus
WP_006856457  93 QYFLGMEKFSHQAPIKPSVIVSFRKRLTAd--yLMEVNEYILEIsgvtkehepKNESKNAKAANtrsd-----dienLGT 165 Roseburia intes...
WP_006907146  91 QYFIGLHGYQQKAPYAPSLLVEFRKRLTDe--iLGEINEMIIRHnhpddpgpgSRDAAPNDGEPse----------nSGT 158 Shuttleworthia ...
WP_007277908  90 QYFLGFERYKQEAPFDSSMMTHFRKRFGAq--dIKDIDELLHTA---------TRKKEEDSNDDsdnd-----ppsnKGS 153 Lentisphaera ar...
WP_012267176  91 QYFLGFSAYSNEPQFEASMLVHFRERITRe--lINKVNRFMVKN---------SREIKEEENTEkklesetqsqpenRGK 159 Microcystis
WP_008274984  91 QYFIGLEAYTFEAPFEASMMVHFRQRINVe--mVNKINEEMVKT---------GREKTEQKEEKsssdseeigerenKGK 159 Crocosphaera ch...
WP_015957362  91 QYFIGLNSYQQEPPVDASMLVHFRKRISVe--lVNKINQEIVKRekdk--ldsQVKKKGLRPEQrek-------itnQGK 159 Rippkaea orient...
WP_012473948 163 LIVDATCAPADIAYPTDIGLLNDAREKTERMIDELCAMHPEGVs--kPRTYRKRARKDFLAVGMKKKLSKKALRKGLGKQ 240 Chlorobium phae...
WP_011673997 144 VILDATVTPVNIKYPQDYVLLGQARRNTEAMVTDLAHKLEVPI----PRTYRREAERNYVHFTKHPKRTRKATRGMVKSQ 219 Lacticaseibacil...
WP_041092043 146 VITDATAFPVNVAYPQDTHLLNGTRLKLEADIKLMSNQLKLAP----PRTRKREAKKQWVAFSRHPHRWGKQTHKQIKAQ 221 Paucilactobacil...
WP_003605947 148 LITDATAVPIEIRFPQDTSLLNQARLNLEEMLLDMAHQLQIKP----PRTYKREAKAKWTAFARKPRRWAKETRKQIKVQ 223 Lacticaseibacillus
WP_006856457 166 AILDATCSPSNIRYPQDFSLLNEAREKLEDMIDYF---HKNYHpwdkPRTYRRIARKEYLALAKSKKRTEKKIRATIRKQ 242 Roseburia intes...
WP_006907146 159 LILDAACAPQNIAFPQDINLLNEAREDLETIIDTVC----YEYnepkPRIYRRNARKDYLALAKQRRRSSKAIRKAIKKQ 234 Shuttleworthia ...
WP_007277908 154 LIVDASCVPGDIHYPTDLGLLNKAREKTEEVIDILWCHRSNTEdkvkPRTYREDGRKSFLSIVLKKRVSKKKRREVINRQ 233 Lentisphaera ar...
WP_012267176 160 LILDASCAPADISYPTDLNLLNQGRKQTEKIIDILYETIKGKLvq-kPRTYRLLARKSYLEVAKKRKPTVKQRRKALKRQ 238 Microcystis
WP_008274984 160 LILDATCAPGDIKYPTDLEILNQGRKATEQIIDSLYKSIKRRLkk-kPRTYRNIARIEYLRIAKKRRSTKKEGREAIRKQ 238 Crocosphaera ch...
WP_015957362 160 LILDATCAPADIRYPTDLGILNQARIETEKIINALYKPLRGKQin-kPRTCRRIAKKEYLKVAKKRQPSYQERREAIGKQ 238 Rippkaea orient...
WP_012473948 241 LRYLRRNLEHIARLsgsv-pltvLSARWHRDLLVIGELYRQqlemwqsGKKSISdRIVSISQPHVRPIVRGKAAAK--TE 317 Chlorobium phae...
WP_011673997 220 LQYLRRNLRYIHEFqdq---ggqLTSKQTQRLEVIETLYEQqdymyrnNTHSVErRIISLSQPFVRPIKRGKAKPRngTE 296 Lacticaseibacil...
WP_041092043 222 LQYIRRDLRFVDELlaq---ggqLSERRLKVLSTVRKVYEQqdymyrnHTHHVSdRIVSLTQPEIRPIVRGKAKQP--VE 296 Paucilactobacil...
WP_003605947 224 LQYVRRDLRYIDVLlah---gasLNERQTKRLAVIRELFDQqmfmyenRTHRVPgRIVSLAQPWIRPINRGKAKQR--TE 298 Lacticaseibacillus
WP_006856457 243 LGYVKRDLEYLEDYmea---gyaLPSKHIDYYLTIQKLYEQqkymyenKTHSVEdRIVSISQPYLRPIVRGKAKSP--VE 317 Roseburia intes...
WP_006907146 235 LQYVRRDLGFIDTFlee---gkeLSARDAERLAVLRRVYEQqrymyenNVHTVAdRIVNISQPYIRPIVRGKAKTP--TE 309 Shuttleworthia ...
WP_007277908 234 FHCVRRNLASIDELkkya-dltlLKPSLYRELLVIGTLYQQqqymydnKVTSVDdRIVSIHQPHIRPIVRGKAGAH--TE 310 Lentisphaera ar...
WP_012267176 239 LQYLKRNLDHIEQLlaegaslqsLKKRDYKLLLVVTEVYRQqlwmyqnNKQSIEdRIVSLTQPHIRPIVRGKAGKP--VE 316 Microcystis
WP_008274984 239 LKYIKKNLVSIEKLilegatldsLNKRQRNLLEVVKKVYEQqqqmwekETQSVSqRIVSINQPHIRPIVRGKAGKP--TE 316 Crocosphaera ch...
WP_015957362 239 LKYVKKNLGQIEQLikagadlkkLSNRRQNLLNTVKKVYEQqqqmwddKTQSVPqRIVSLTQPHVRPIVRGKAGKP--VE 316 Rippkaea orient...
WP_012473948 318 FGMKLSISVV-DGISMPERMSWNAYNEGCDLVRSIERYRERYGHYPESVHADKIYRTQANRRWCKerEIRLSGVPLGRPP 396 Chlorobium phae...
WP_011673997 297 FGPKVDVSII-DGVVGIERFSFDNFNENQDFEDALYHYHDVHGEFPDMALVDKLYRTRENLRIAKnlGVKVCGPKLGRQP 375 Lacticaseibacil...
WP_041092043 297 FGPKVDLSIT-DGVVNIERFSFDSFNESTDFASTIDHYKDVHGVYPDEVLADTLYRTRANIKLCKdlGIKLSGPKLGRRP 375 Paucilactobacil...
WP_003605947 299 FGPKIDASIA-DGMIDIERFDFKAFNESQDLATTIDHYFDVHGYYPDEILADTLYRTRENRQLCQrlGIRLSGPRLGRKP 377 Lacticaseibacillus
WP_006856457 318 FGAKYDVSIDeKGHARLEKLSFDAYNENTIFVDAMNRYKERTGHYPKRVLVDQIYRTRDNRNFCKdhNITMSGPKLGRPS 397 Roseburia intes...
WP_006907146 310 FGTKLDLSIDdHGIARIEKQSFDAYNEGDVLIGAIEQYKERTGHYPDRALVDKIYRNRKNLSYCRlhGIKLSGPALGRPK 389 Shuttleworthia ...
WP_007277908 311 FGAKISISVV-DGWTFTDTISFDSYNEGTELISQIEKYKERFGYYPESTHADKIYRNKENRAHCKkhGIRISGPSLGRPP 389 Lentisphaera ar...
WP_012267176 317 FGAKFSASCI-DGYIFLDRISWDNFNESGDLKAQIEAYYDYTGYYPESVHVDKIYRTRENRAWCKerGIRISGPPLGRPA 395 Microcystis
WP_008274984 317 FGAKLSVSYV-DNYIFLDRISWENFNESGDLQGQVEKFKQTYGCYPSSVHADRIYRSKANKDWCKqrGIRLSGIGLGRPP 395 Crocosphaera ch...
WP_015957362 317 FGAKLSVSCV-DNYVFLDRISWENFNESCDLKEQVEKYRKTFGYYPESVHVDRIYRTRENRAWCKarGIRISGPQLGRPP 395 Rippkaea orient...
WP_012473948 397 KDvekn--rarRRQIREDEG---IRNAVEGKFGQAKRRYSLNRVMARLAESSLSVVSITFLVMNLDRLLAA 462 Chlorobium phaeobacteroides
WP_011673997 376 KYpdeaserkaKKEAREAEN---ARGEIERNFALMKLKHGLGLVRAKTVETITTTVFTAMITANIDAVLRL 443 Lacticaseibacillus parac...
WP_041092043 376 KHvdp----akRREEQDAEN---RRGEIEREFSLIKSKLGLGLVTAKTAETIAVTVDTGVVLANLKRVLSF 439 Paucilactobacillus hokka...
WP_003605947 378 KKmda----kqRQIDRDAEK---RRGKIERGFAFMKGPLGLSLVRTKTVASIAVTIDIAINLANLKMLLRL 441 Lacticaseibacillus
WP_006856457 398 KD---------KKSTKEEYQdntDRIEVERFFSTEKRCNGAGLIMTKLEETTLSSIAMSVLVTNLFAVDLT 459 Roseburia intestinalis
WP_006907146 390 KDps-----idRKQEYRDAV---DRIEVERSFSLAKRCFGLGLIRTKLDTTTRSSIVLSIIAMNVDRLTVF 452 Shuttleworthia satelles
WP_007277908 390 KDeklr--keqKDIQRQDEA---IRNQVEGCFGVAKRRYKLDRIFTKIKASSETLIALIFMVMNLDKALAF 455 Lentisphaera araneosa
WP_012267176 396 KNvsk----eqKKQATDDER---IRNCIEGKFGQGKRRFSLGKVMAKLPHTSFSAIAITFLVMNLSNLLRQ 459 Microcystis
WP_008274984 396 KNisq----eeKRQTKIDEG---FRNRIEGKFGQAKRKFSLDLVKTKLKETSETAIAITFLVINLSQLLRQ 459 Crocosphaera chwakensis
WP_015957362 396 KNisk----qeKKQALDDEC---FRNAIEGKFGQAKRRFSLKLVMTKLPETSETSIAITFLVVNLGRLLRQ 459 Rippkaea orientalis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap