Conserved Protein Domain Family
motil_scm1_spiro

?
NF033571: motil_scm1_spiro 
motility-associated protein Scm1
Scm1 (Spiroplasma citri motility gene 1) was shown by loss-of-function mutation to be involved in motility. The Scm1 family is widespread in the genus Spiroplasma, members of the Mollicutes (bacteria with no cell wall) that have a spiral shape organized around a contractile ribbon fibril made of repeating subunits of the Fib (fibril) protein.
Statistics
?
PSSM-Id: 468090
Aligned: 15 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_025251075   2 RNKALTIATITSTSFFILCLIVIFSLVPAIDSDAIFNQLRPNG-----GEVNEGywDVVASNVQNPFSLAYFALGFFSFN 76  Spiroplasma sab...
WP_071937282   2 TLKSWLKFSTIWFLAVIVIIIAGAVVPTLNQQVTALKQEIINSls--vKGLNPN--PLETLQGDSAYNILNFLLSYGSFQ 77  Spiroplasma citri
WP_070406814   2 TIKSWLKFSSIWFLAGIVIIMAGAVVPTLNQQVGALKEEIIKSls--vNGLTPN--PLESLKGDSAYNILNFLLSYGSFQ 77  unclassified Sp...
WP_047791331   2 ALTSWLKFGAIWAIFVIFAIIGIAVTPSLNNQVGAIKNNIITNls--iEGMTNN--PLPNIKANSAYNLLNFLLSYASFQ 77  Spiroplasma eri...
WP_025363094   2 KHKVVWTVTICFAIIFTALFVTTLCFGFSIDVKKEIDNLIKTSs---eATEYLTl-ASQN--INSSFGLAHFIFGVEGIS 75  Spiroplasma cul...
WP_023789420   2 KHKTLIIITSSFAITFLTFLIISLVLNNKVNISNEIDNIMKFLgd--eGKEYFTr-VKNN--LKNPIDLAYFVFGLEGLP 76  Spiroplasma apis
WP_100254557   2 RHKFLYATSLATGLAFISILITTCVLASTINVSDELKKIAEFGqsnaeFDRYINl-LIDGGQIKNPFQLATFSFWTEGFI 80  Spiroplasma cla...
WP_020834264   2 KNKNIFITNIILAILIIITLIVTLVQLLSIDVSKELNIWSCk-----lNDFSKK----LETNISNPIDLAYFLFGFIGFS 72  Spiroplasma tai...
WP_101780691   2 KHRNTYTFAIVITVLLVIAFIVAGTVGKTVDVEAILQYKMQna---swKEIEGm--DQLAKNVNSPLSLAFFLFGVGGIG 76  Spiroplasma mon...
WP_100916511   2 KHKNTYTIAIVITVLLVTTFIVAGSIYSSIDVTKILENKLSEKnndswTNIQGQnfEVLKTTITNPLSLAFFLFGIGGVD 81  Spiroplasma flo...
WP_025251075  77 GMIKIgVPFVFGCFVLFLVILLPISFIGFFFFGGIYCYKILIDRT-KQYRYDEIRKINQWIIYVAGISAIVFLAIGFIIF 155 Spiroplasma sab...
WP_071937282  78 AIFSL-NGFALFKFWVIDLYIFVPIFTLIAVGTAIFVIVLLTNITaAHWKWNVRLLVGKWMTRIGSLTLYLSLFLGLFFI 156 Spiroplasma citri
WP_070406814  78 AIFSL-DGFGLFKFWVIDLYIFVPILSVFAVGTAIFVVVLLTNATaAHWKWNARLLVGKILTIGGGITLYVALFLGLFLV 156 unclassified Sp...
WP_047791331  78 GFFAL-DGFSLFKFWALDLYIFLPIFGIISAGTGLFVLILLLNVKsPHWKWNIRLKVGKLCLWIGAVSCYIALFLGLFLI 156 Spiroplasma eri...
WP_025363094  76 SIINN-HSFNTAFFTLMWSFFLPLLGVILGSLSLIVFSLFFVERIkRQFKYQYVKKTGIIGMYISFSCFLLLSLIAIVLM 154 Spiroplasma cul...
WP_023789420  77 TMIKV-HSSLLVFIAVMWSFLLPMLGIILGFLLSISVFLTIIEKIkRQYKYDAIKTVGKYGMYVSFGIFIFIAIVGLITI 155 Spiroplasma apis
WP_100254557  81 TTYQI-HSFAAATFIFFWSFVLPIVAVAFGINLVTMISLIFVERIrKEYQYKTLKAVGKWGMYSSFLVFAVCAITFIILI 159 Spiroplasma cla...
WP_020834264  73 ELIAH-NSISMILFAIGWVVFLPILFILFSFFLTTYITLFCVKRIrREMDYKTVKTAGKWGMYASFLSSILFSLIALLLV 151 Spiroplasma tai...
WP_101780691  77 ELAGTpGWFGLMVFTVTSVIIIPALLIFFVALLSVLSVLFGVEFVrRDAEVNKIKMIGKWGMYAGFAATFLFALIGVVLF 156 Spiroplasma mon...
WP_100916511  82 ELKATsDPFKLIVFTITSIIIIPTLLIVFFLYMSIIITLTLIEFIkRDSEVMTLKNVGKYGMYVSFISSFLFALIGIIIF 161 Spiroplasma flo...
WP_025251075 156 LSMESNLKDSGILSAWGGTHNNQqivnikliHVFEYITGLKYLFSshLTGLLTSGINDHLNSlgpsfQNWSVNEGLVITS 235 Spiroplasma sab...
WP_071937282 157 AIADGFAFVLREKICWYNLTNGQ--------GLVTWINNGQYQPN--VFSIFGLIINQDGLG-----AFFAQAPMIMQAG 221 Spiroplasma citri
WP_070406814 157 AIADNSNFVNGQEKNWYNLTNG---------GLVTWTNNVQYQPN--VFSVLGLSINQTGLS-----TFLAQAPGVLQVG 220 unclassified Sp...
WP_047791331 157 SITDNSHTVNGYKEIWYGTNIVD--------GVIHWTNGQPYQPN--VFSVFGIIMNQDGLD-----GIFNLTNGAIKAG 221 Spiroplasma eri...
WP_025363094 155 SILETQFNSNDGLKSILDSINlsn-----vhNGFSYITIIKYWTNngLSKMINGGIKNIEGl-----DFTNINTSMLSAA 224 Spiroplasma cul...
WP_023789420 156 SLLEGQLNQLENVNKIWNSLDKNyfss-nlkNSFTYLTIIRYHFQngLSSLLGNGINEINNt-----YNGNVSLNLLQAS 229 Spiroplasma apis
WP_100254557 160 AFLEKQFDKVSLLDQGSKSFGsae-----yqTDHTRINSFNFFLNgtLATMFGNGLIHVDSRi---iDSTIINTNMLITT 231 Spiroplasma cla...
WP_020834264 152 SFLEPSFNKSQLSSNLQLTKNYD---------AFSIITLLTYLTNstIFGAASNDFLEFLGQ--------NFNLPLFITT 214 Spiroplasma tai...
WP_101780691 157 CSIEQSLKQ----DLNFKFNNYD---------AFGIMTFLTFLSNgtVFGGVKS---ELLSN--------EHVISSLNAG 212 Spiroplasma mon...
WP_100916511 162 CSIENNLQK----NYQG-FEKYD---------SFSIMTFLIHLSKgtIFSWEKN---GLLNS--------PNIVTTVNVA 216 Spiroplasma flo...
WP_025251075 236 LVFLVILSPIASIVAVNAIVFRFAAMYSNKSRDe-----IQHFHNWIDYRGIYTKREFREMLFKNLWFWVAVGGFALSIL 310 Spiroplasma sab...
WP_071937282 222 AVLIIFMMPLAVASVVIGLSIRIAIELLLPSSAghrggfVTTFMQWLGYINISSRRELCQRLGSNIGMILLMIGFIVIMI 301 Spiroplasma citri
WP_070406814 221 AVFIIFIAPIAVAILTVGLAIRIAIELLLPSSSshrgglGASFVQWLGYINISSRRELRKRLGSNIGMILLMIGFLVVMI 300 unclassified Sp...
WP_047791331 222 TIFLVFLTPISLMLLVIGLALRMAISILMPSSSsy--rgNNQFLAWLRFINISTKKELRARMRSNIGMIVLGIGFAVIMI 299 Spiroplasma eri...
WP_025363094 225 MIICIIGLPITLILSIVFNSIWISTFISSREGG------MSKFTLWLQNVRIDSKREFYGAIFKNIWVLTGLILFITSII 298 Spiroplasma cul...
WP_023789420 230 LVFIVILLPISLSSLIIFSTMWAATFISTRNNG------MSKFTGWLGNVRIDSKREFKSMILKNAWFWFLIITYILTMI 303 Spiroplasma apis
WP_100254557 232 NIFLAVLIPISLICTISFSSIWIATFISNRNNG------LSKFSRWLGNVRIDSRREFAGVILRNWWFWILAACFLVTII 305 Spiroplasma cla...
WP_020834264 215 VIFLVIFLPINGLALVFFSSMWVSTFITDRGGT------HSKFWLWLKNIRIDSKREYYGLVFKNIWLWLLVVSFFITIL 288 Spiroplasma tai...
WP_101780691 213 ITFLVVLLPMAAIVMMAFASMYIGVFISKRESK------TSRFFNWLKNIRIDSLRDYISLNIKNPWIWILSLTFIATVI 286 Spiroplasma mon...
WP_100916511 217 LVFLVILLPIAFFCLIIFSSFYIAIFVAKKDSR------SSRFFNWLKNIRIDSLKEYIQLNLRSPWIWILSITFAFTII 290 Spiroplasma flo...
WP_025251075 311 APGVIHD-YSQPEHFIVTTVVLIIAVLTFIPTIVQRILIGKIVKIAQHKIMFFQQVLLIIVGVIVQLVLWLGFKDLFNYS 389 Spiroplasma sab...
WP_071937282 302 FPAFTSTtGYVTANWIILLVAIVLMIISFIPLYFMLFCLARLQEFSYNLLMFVQMLTWLVIGLLWQTLMWTIFRQYFQYP 381 Spiroplasma citri
WP_070406814 301 FPAFTSTtHYVTANWVILGIAIVLMIISFIPLYFMLFCLARLQEFSYNLLMFIQMLTWLVIGLIWQILMWTEFTQYFQYP 380 unclassified Sp...
WP_047791331 300 FPAFISTkKYVATNYILLVISILLMAISLIPIYFMWYRLSQLQQFSYNLLMFLQMLIWLVIGLIWQILMWTEFKAFFKFP 379 Spiroplasma eri...
WP_025363094 299 FPGIVHP-YQNSMHIVLTVSSLIVLPIALIPLLICWIKIIRIQRFNFNKMMFIQMLIFTLFNSSMQLIVWVLFREEMNMP 377 Spiroplasma cul...
WP_023789420 304 LPGLVHP-YKSPTQITIAVLSIVIMPFALTPILVGWIMAINIKRFNYNKLMFNQLIILWTVTTIIQLTIWTLFREEIAAP 382 Spiroplasma apis
WP_100254557 306 YPGLVHD-YQTGTQITIAVVSLVLLPVCFIPLFIAIYKIFKIRMFNYNKMMFAQILCLSITTTSLQVIIWALFGEQIMGP 384 Spiroplasma cla...
WP_020834264 289 MPGLIHP-YENLTQILIAVFFIIIAPLVFLPIMVGIYMAAKIKRFNYNLLMFVQILVLLFTVLALQINIWIFLKADINVS 367 Spiroplasma tai...
WP_101780691 287 IPGFVHP-YQTTTQILISAINLVSIPLVFSPMIVGYFMAKGIKRFNYNMLMFVQIIILMGATWIFQLNSWIFLKDSMFWN 365 Spiroplasma mon...
WP_100916511 291 IPGFVHP-YTNVTQILITLISIIIIPVAFLPMIIGYIMAKKIKRFNYNRLMFIQILLLTLIILLIQLNASIFLKDYMFKF 369 Spiroplasma flo...
WP_025251075 390 ETFAVLIPITSITIGLISLTFFIKKI 415 Spiroplasma sabaudiense
WP_071937282 382 AVVPVITTFFFVNILLVSFYLLVRGY 407 Spiroplasma citri
WP_070406814 381 AVVPVIMLFFFINILLVSFYLLVRGY 406 unclassified Spiroplasma
WP_047791331 380 AYVPIITIFFFVNILIISFAMLVRGY 405 Spiroplasma eriocheiris
WP_025363094 378 LWMILTWPFIYISLSAIITYGFIKWK 403 Spiroplasma culicicola
WP_023789420 383 TWLMTSWPLVLISFSTASVFGFIKWK 408 Spiroplasma apis
WP_100254557 385 AWLMIGFPLLTIITSILCTFGFIKWK 410 Spiroplasma clarkii
WP_020834264 368 TTISCLVPLITISLAMFGFFGFIKFQ 393 Spiroplasma taiwanense
WP_101780691 366 SWMSAFIPFSTCTLSLVSAFGFIKFS 391 Spiroplasma monobiae
WP_100916511 370 TWLSAFLPLVTCTISMFAAFGFIKFS 395 Spiroplasma floricola
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap