Conserved Protein Domain Family
FIB_Spiroplas

?
NF033570: FIB_Spiroplas 
cytoskeletal motor fibril protein Fib
Fib, a 59K protein also called fibrillin, is the repeating subunit of the linear fibril that runs through the shortest path along the length of Spiroplasma cells, members of the Mollicutes that lack cells walls but have a spiral shape. The fibril is a linear contractile ribbon, and Fib is its only component.
Statistics
?
PSSM-Id: 411197
Aligned: 5 rows
Threshold Bit Score: 933.534
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_071937222   1 MIGVISTAYFTMKDKHSIKTVKKYWWKNCVIQHVKYHGKTFIIATVGYGKANAAMTITYLLEKYPGLQTILNVDLALSTN 80  Spiroplasma citri
WP_020834191   1 MIGIISTAYFTVRDREGIKTVRKYWWRNMVIQHVKYRGKFFVIATIGYGKANAAMAITYLMEEYPTLETVLNVDLALSTN 80  Spiroplasma tai...
WP_100916471   1 MIGIISTAYFTVKDRPGIKTVKKYWWRNMVIQHVKYRGKSFIIATIGYGKANAAMAITYLMEEYSGLETVINVDLALSTN 80  Spiroplasma flo...
WP_075058108   1 MIGIVSTAYFTVKDRPGIKTVKKYWWRNVVIQHLKFRGKAFIIATTGYGKANAAMVITYLMEEYPSLETVVNVDLALSTN 80  Spiroplasma lit...
WP_100254590   1 MIGIISTAYFTVKDRLGVKTVKKYWWRNMVIQHVKYRGKFFIIATIGYGKANAAMAITYLLEEYKTLETVFNVDLALSTN 80  Spiroplasma cla...
WP_071937222  81 DKHDTGDTTISTKFIYRDADLTVFKDIKYGQIVNEPESFQFDGEFAKVVKDFKLGLTEGVTGTADMLIYNSKQFKEMVDK 160 Spiroplasma citri
WP_020834191  81 DKFDTTDTVMATKFIYRDADLTVFKDIKYGQIVHEPEAFAFNTELETQVKNFKLGVSDGIIGTADMLIYNSKQFKEMVDK 160 Spiroplasma tai...
WP_100916471  81 DKFDTTDTVMSTKFIYRDADLTVFKDIKYGQIVHEPEAYAFNTEFASQVKNFKLGVSDGIVGTADMLVYNSKQFKEMVDK 160 Spiroplasma flo...
WP_075058108  81 DKFDTTDTVLATKFIYRDADLTVFKDIKYGQIVHEPEAFSFNTEFVNQVKNFKLGVSDGIVGTADMLIYNSKQFKEMVDK 160 Spiroplasma lit...
WP_100254590  81 DKFDTTDTVMSTKFIYRDADLTPFKDIKYGQIVHEPEAFSFNTELVSKVKNFKLGVSDGIVGTADMLIYNSKQFKEMVDK 160 Spiroplasma cla...
WP_071937222 161 YGHTIDVIDTEAGAIAQVAKKSSINYIALKIIYNNALSPWDNDPIHKFKMYETVNTLKYLLRRLFNLLSSNYIIDLSQCS 240 Spiroplasma citri
WP_020834191 161 YGQTIDVIDSEAGALAQVAKKSSVNFVAMKIMYNNALSPWDNDPLHKFKIYETTNTLKYLVARLFNLLSSKLFIDFSKST 240 Spiroplasma tai...
WP_100916471 161 YGQTIDVIDTEAGALAQIAKKSSLNFITMKIMYNNALSPWDNDPLHKFKIYETTNTLKYLLARMFNLLSSKYVIDFTKST 240 Spiroplasma flo...
WP_075058108 161 YGQTIDVIDTEAGAIAQVTKKSSVNFIALKIMYNNALSPWDNDPLHKFKIYETTNTLKYLLARLFNLLSSRLVLDFTKNN 240 Spiroplasma lit...
WP_100254590 161 FGQTIDVIDTEAGAIAQVSKKSNVNFVSMKIMYNNALSPWDNDPLHKFKIYETTNTLKYLLARLLNLMSSNYIIDFTKNS 240 Spiroplasma cla...
WP_071937222 241 QDDLDSINELFEIKHDQWIKLFKPNTHKVLSGFGPSLMLVDKQEKTPVALDIIQVIRSKTKEaEGPSKVILGEDEWKNAP 320 Spiroplasma citri
WP_020834191 241 IDELDVINELFEMEHDAWTKRFKKNVSSLLSGFGPSLMLVDSKAATPEAVDIVEVMKTKIED-EGPSKIILGEDEWKNAP 319 Spiroplasma tai...
WP_100916471 241 NDELEVIHELFEMEHDAWVSRFKTNTASLISGLGPSLMLVDKKGITPEAIDIVEVMKSKIED-EGPSKVILGEDEWKNAP 319 Spiroplasma flo...
WP_075058108 241 NDELEIINELFELSHDAWPKMFKKNVVKLVSGLGPSLMLIDKKGVTPEALDIVEVMKKKIED-EGPSKIILGEDEWKNAP 319 Spiroplasma lit...
WP_100254590 241 HDELEIINELFELEHDAWVKRFKKDTVSIISGLGPSVMLIDKKGQKPEALDIVEVMKPKIEE-EGPSKVILGEDEWKNAP 319 Spiroplasma cla...
WP_071937222 321 KKWLRKLLFLEQVRVNDDELLWNKSAKYDLNNEKLYKIETVANEIAAAIAEKCQDKSSYTYNGATVPEKYLLVNCDARIS 400 Spiroplasma citri
WP_020834191 320 KKWLRKLMFLQNVHVNDDELLWNKSAKYDTRSHKINSIEDVAKAISKAISDRSQDKSSYTYDGATVAKKHLLVTVDAAIS 399 Spiroplasma tai...
WP_100916471 320 KKWLRKMMFLTNISVNDDELLWNKSAKYDLKAAKIHSIEDVCKAVSKVIADRSQDKSSYTYDGATVLKKHLLVTVDAAIS 399 Spiroplasma flo...
WP_075058108 320 KKWLRKLMFLQNIHVNDDELLWNKSAKYDLQTEKMFSIEELAKQIAKVIADRSQDKSSYTYDGGTVIKKHLLVALDASIS 399 Spiroplasma lit...
WP_100254590 320 KKWLRKMMFLENIHVNDDELLWNKSAKYDLKNAKIYSIEDVTKNISKLIADRSQDKSAYAYDGTTVNKKHLLVAIDAPIV 399 Spiroplasma cla...
WP_071937222 401 FYITHNQSHEFVEDKNFGTQLVSNEFVKYLNEALKDVDSPYQQIVIYMTIPALDYRKISVFIPSNKGANRGVKFVALNQK 480 Spiroplasma citri
WP_020834191 400 FYITNNSTHEFVEEPKYGSKLVANEFTKFLNEQLAEVDSPFEKIIVYIKIPAIGASKLPVFIQTKSKANTPIVFGGYSAK 479 Spiroplasma tai...
WP_100916471 400 FYITHNLTHEFVESPHHGSKLVLNEFVKYLNQQLADVESPYDKVIVYFKIPTVNSSKLPIFVQTKTKANQPIVFAGYSAK 479 Spiroplasma flo...
WP_075058108 400 FYITHNETHEFVETASQGSQLVANEFMKFLNEQLAEVESPFSKIVIYIKIPAMGAAKLPVYITTKNKVNTPISFSGYSQK 479 Spiroplasma lit...
WP_100254590 400 FYISNNDTHEFVDSRKHGSQLVANEFIKFLNAQLAEVESPFEKIIIYGKIPAIGATKLPIFITTKSKANQPIVFSGYSQA 479 Spiroplasma cla...
WP_071937222 481 LQRDYTVVDITRNDYDPIKVGSFKVTIRLKSE 512 Spiroplasma citri
WP_020834191 480 EQKTYTVVDITRNDYDPLKVGSFKVTIRLKNE 511 Spiroplasma taiwanense
WP_100916471 480 DQKTYTVVDITRNDYDPLKVGSFKVTVRLKNL 511 Spiroplasma floricola
WP_075058108 480 DQKVYTVVDITRNDYDPLKVGSFKVTIRLKND 511 Spiroplasma litorale
WP_100254590 480 DQKKYTVVDITRNDNDPIKVGSFKVTIRLKSH 511 Spiroplasma clarkii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap