Conserved Protein Domain Family
lass_lactam_cya

?
NF033535: lass_lactam_cya 
lasso peptide isopeptide bond-forming cyclase
Members of this family are the isopeptide bond-forming cyclase of lasso peptide biosynthesis systems, from a subgroup that contains primarily cyanobacterial examples. These proteins resemble the glutamine-hydrolyzing asparagine synthase AsnB (EC 6.3.5.4).
Statistics
?
PSSM-Id: 411170
Aligned: 18 rows
Threshold Bit Score: 985.641
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_019489786   1 MSGIVGIYNLNG-ADVDRKDLGKMVDILAHRGYDGADIWAES----SIGLGHRMLWTTPESLLEKLPFSDEKCEFVITSD 75  Calothrix sp. P...
WP_010913075   1 MSGVAGILLRQEaPADAATDIQRMLARMRHRGPDGNSWWLDS----GIALGHAWLNTTDEAGPG--PLTMAGGKLAITAD 74  Mesorhizobium j...
WP_006205260   1 MSGIAGILPRQQgRPTAAADIQQMLARMQHRARDGSSWWMDTtaplGATLGHAWLNTTDEAGPG--PLTMAGGKLAVTAD 78  Mesorhizobium a...
WP_016872084   1 MSGMMGIYYLDG-RSVDKQDLEKMVNTLAHRGPDGADIWHDG----NLGFGHRMLWTTPESLLEKLPLVNQTGDLVITSD 75  Fischerella the...
WP_008188038   1 MSGIVGIYYLNQ-EPIDRENIGQMLDILAHRGPDGADIWCEG----SVGLGHRMLWTTPESLLEKLPLVNHSKNLVITAD 75  Moorea producens
WP_009149817   1 MSGIVGIFDLDG-CAVKQTDLSQMLDTLAHRGTDAANVWCEG----EVGFGHRMLWTTPESLLEVQPLVDSERNCILTAD 75  Moorea producens
WP_006518642   1 MSGIVGIYHLDQ-RLVESSDLHQMVDVLMHRGPDGTDVWCQE----AIGMGHRMLWTTPESLHEQLPLVKG--DLTITAD 73  Leptolyngbya sp...
WP_015205178   1 MSAIAGIYYLDN-RQVDRADLVKMTDILAHRGPDGSNVWTKG----AIGIGHRMLWTTPESLLETLPLVNETGELVITAD 75  Crinalium epips...
WP_015192036   1 MSAIAGIFYIDK-KPVERNHLTKMLDILAHRGSDGANIWSED----NVGFIHRMLWTTPESLLESLPLEKNN--LVITAD 73  Stanieria cyano...
WP_015116645   1 MSGIVGVHYLDG-RPVNGEDLSKMVDILAHRGPDGADTWIGQ----SVGLGHRMLWTTRESLIETLPLVKQDGNLVITSD 75  Rivularia sp. P...
WP_019489786  76 ARIDNREELIDALQFNNCPPEKITDSELILAAYKKWGNSCPEQMLGDFAFAIWDKRNQSLFCARDHFGVKPFYYhHKPDS 155 Calothrix sp. P...
WP_010913075  75 CRLDNRDELMARLGIRDRSV---ADAVLLMRAYLRWGESCPVHLQGDFAFAIWDAERQLLFCARDHFGVKPFYY-HAADR 150 Mesorhizobium j...
WP_006205260  79 CRLDNREELLARLGIRDSSL---ADGSLLMRAYLRWGEACPTYLQGDFAFAIWDSERQALFCARDHFGVKPFYY-HADDQ 154 Mesorhizobium a...
WP_016872084  76 ARIDNREELLSILQINDCPLEKITDTQLILAAYQKWEELCAEHLLGDFAFAIWDRKKQTLFCARDHFGVRPFYYyYQPNQ 155 Fischerella the...
WP_008188038  76 ARIDNREELIVALELNDRPAEKITDSQLILAAYEKWGEQCPEKLLGDFAFAIWDKHKQILFCARDHVGVKPFYYyHQSGQ 155 Moorea producens
WP_009149817  76 ARIDNRDELITTLELAEQEPEKITDSDLILAAYHRWGKDCPQYLLGDFAFAIWDQSQQQLFCARDHLGVKPFYYyYQAEK 155 Moorea producens
WP_006518642  74 ARIDNRDELAQVLNLPDRPLEKVTDSEFILAAYEKWGSECPEHLLGDFAFGIWDGQKQQLFCARDHLGVKPFYYfHQESN 153 Leptolyngbya sp...
WP_015205178  76 ARIDNRDELIEALELTQRPAEKITDTELILAAYERWGEECPKHLLGDFAFAIWDGRKQELFCARDHFGVKPFYY-YCSDK 154 Crinalium epips...
WP_015192036  74 ARIDNRDELISALELNHLPKEKITDSGLILAAYQTWGEQCPEKLIGDFAFAIWDKQKQQLFCARDHFGIKPLYY-HSSDS 152 Stanieria cyano...
WP_015116645  76 ARIDNREELIAALQINNRPSDKIGDSELILAAYGKWGEQCLEHLLGDFAFAIWDKGKQQLFCARDHIGIKPFYY-CRNSD 154 Rivularia sp. P...
WP_019489786 156 IFAFSSEIKALFELKQVPRCLNEVRMGDYLALMMEDRVITSYQDILRLPPAHSMVVNQQGIQLWSYWSLDPNREIKLASN 235 Calothrix sp. P...
WP_010913075 151 RFAFASEIGPMLGLDGVGARISEHRISGFLAGLPDDPQSTPYSDIFTLPARHSLTVTAQQVVLRRYWQIEPS---VRPAR 227 Mesorhizobium j...
WP_006205260 155 RFIFASEIGPILGVGGAGARLSEHQISGFLAGLPDDPQSTPYTDIFRLPARHSLTVSDSKVVLRRYWQIEPS---PRPMR 231 Mesorhizobium a...
WP_016872084 156 EFIFASEIKALLCLPQVPRRLNEVRIGDYLTLMMEDQKITTYKNILRLPPAHSMVVSQSGIQQWSYWSLDPEHEIHLADN 235 Fischerella the...
WP_008188038 156 GFIFASEIKALFCLPFVPKRLNEVRMADYVALMMEDKVITTYDEILRLPPAHTMVVSQSGIELNCYWSLDPNRELILDSD 235 Moorea producens
WP_009149817 156 AFLFASEMKALFCLPQIPQRINEVRIADFIMLMLEDKVITTYENVFRLPPAHSLIINQTELRTWSYWSLDPSKELHLESD 235 Moorea producens
WP_006518642 154 TFAFASEIKGLLCLDWIPQQINEVRIADYLALMFEDKVVTTFEDIVRLPPASRLWADASGIRVETYWQLNSNYELKLDSD 233 Leptolyngbya sp...
WP_015205178 155 TFIFATEIKAIFCLSEVPNQINEIRIADYLVSNFDDKTITSYQDILRLPPAHRMIVSHIGKQLEPYWCLDPTREIRLTSN 234 Crinalium epips...
WP_015192036 153 IFVFASEIKAIFCLSEIPQVINEERIGDYLIGNFDDLAITSYQNIFRLPPASFMTVTSEGININSYWSLDVTKETRFDSN 232 Stanieria cyano...
WP_015116645 155 TFVFASEIKAIHTLPNIERKVNETRIAEYLLIVFEDKTTTFYQDIFRLPPGHCMTVSKEDIKIRCYWELNPQKELRLGSD 234 Rivularia sp. P...
WP_019489786 236 EAYALEFKRIFTEAVRCRLRSAFPIISHLSGGLDSSAVTCIARSILREKKKTPLHTISTIYDKIKECDEREYMNAVIEQG 315 Calothrix sp. P...
WP_010913075 228 SDAAEEFAHLFSQSVRNRMRGSRSVGAMLSGGLDSSSIACVAGLQNAAERKPKLPTFSLVFEKGSSMDERAFIDAVLDQH 307 Mesorhizobium j...
WP_006205260 232 SDAAEEFRHLFSQSVRNRMRGTPAVGAMLSGGLDSSAIACVAGLQNAMARKPRLPTFSLIFERGSSMDERPFIDAVIGQQ 311 Mesorhizobium a...
WP_016872084 236 EAYAQEFRQIFTEAVKCRLRSAFPLISQLSGGLDSSAVTCVARNLLAEVGKTPLHTISSIFDKVTECDERPFINAVLEQG 315 Fischerella the...
WP_008188038 236 EAYAEAFRDIFTEAVRCRLRSAFAIGSHLSGGLDSSSITCVARKLLAETGDAQLHSFSNIFDKVTECDERPFINAVLEQG 315 Moorea producens
WP_009149817 236 QAYADAFREIFTEAVRCRLRSAFPIGSQLSGGLDSSSITCVARDLLAETKKPPLHTFSCVFDTLKQCDERSFIEAVLNQG 315 Moorea producens
WP_006518642 234 DAYAEAFREIFIEAVRCRLRSAFSVGSHLSGGLDSSSVSCVARKILSETTGETLHTFSNIFDTVKECDERSYIDEVLKQG 313 Leptolyngbya sp...
WP_015205178 235 EEYAEKFLELLTEAVRCRLRSAFPIGSALSGGLDSSFISCIARDILNEDGTKKLHTFSAIFDKLPQCDERPYINAVLNQG 314 Crinalium epips...
WP_015192036 233 EEYAAKFLEIFTEAVRCRLRSCSNVGSMLSGGLDSSSITCVARKLLPEE--QQLPTFSAIFDRIKECDERQYINTVLKKG 310 Stanieria cyano...
WP_015116645 235 EEYAEAFREIFTEAVRCRLRSAFPIGSTLSGGLDSSAITCLARNLLDKN--QPLHTFSVIFDEMSQCDERPFINEVLAQG 312 Rivularia sp. P...
WP_019489786 316 GLAPHFVHGDEIGPLSNLDMIFQYEDEALLGPSHF-YPWLVNRETKKLGMRIALDGFDGDSTVSHGITRLTELALQGKWK 394 Calothrix sp. P...
WP_010913075 308 KTDPTLIPVGNYAPFAEFERVLEEQEGTFLAPGLT-LTRGIYRTAGAKGIKVLLDGHGGDEVVSQGHGHLHELANGGRWL 386 Mesorhizobium j...
WP_006205260 312 KVDGTLIAVGSYAPFAEFERILEEQEGTFLAPGLS-LTRGIYREAGANGMKVLLDGHGGDEVVSQGHGHLHELANAGKWI 390 Mesorhizobium a...
WP_016872084 316 GFIPHYIHGDEFGPLSNLDSIFQYEDEALLGPSHF-YPWMVYRAAKELGMRITLDGFDGDTTVSHGIARLTELGRQGKWK 394 Fischerella the...
WP_008188038 316 GLIPHYVHADQFGPLSDVDEIWEYEDEALLGPSHH-YPWRLNQAAQQAGMRIVLDGLDGDNVVFHGVSRLTELAHQGQWE 394 Moorea producens
WP_009149817 316 EFIPHFIAGDQIGPLSDIDQIFEYEDEAFPGPNYY-FPWRLTQIAKKQGVRILLDGHDGDNIVSHGIYRLTELASQGKWA 394 Moorea producens
WP_006518642 314 GYTPHYIHADAFGPLTDVEQIWNYEDEPILGPSHH-YPWRLNQAAHEEDVRIVFDGFDGDSVVSHGLDRLRELALQQKWS 392 Leptolyngbya sp...
WP_015205178 315 GFEPHYIYGDESSPLENIKDIFWHQDEAFFAPNLS-MTWSIQETIQKQGVRIQLEGFDGDSTVSYGFGYLHELAQERRWL 393 Crinalium epips...
WP_015192036 311 NYQPHYLNADLRTPLTDINKIFEHEDEAFFAPGFAmMTWGICELARDKGVNIILDGYDGDSTVCHGSGYLHELAKEGYWL 390 Stanieria cyano...
WP_015116645 313 NFTPHYLNGDKLTPLEDINRMMWYHDEPFYFANSY-LYWNTCPIAKNEGIRILLDGFDGDTSVSHGLGYFDELANQGRWF 391 Rivularia sp. P...
WP_019489786 395 IFFKEAKAVSSNYSVSLIDLFRGYGLLYFRQQAIKFQWLKFLIAVQQIHNHLGGSRKQLIIYHGLKPLW-AEFKklftnf 473 Calothrix sp. P...
WP_010913075 387 DLWREVRSASNTYGDSTLGLYFQF--------------LTLYGPAWRIAKARQLANRALNRIRK---------------- 436 Mesorhizobium j...
WP_006205260 391 ELWREIRSASNTYGDSMLGLYYQF--------------LTLYGPAWRIAKLRHAARRILGRVRS---------------- 440 Mesorhizobium a...
WP_016872084 395 ALIQEAKAIAAQHNVSPYVVFRGHGLPYLQDLVKKWQWIEFVKTVQLIHKHFGVSRKLLIIAHGIKPFW-EQVRlfwrg- 472 Fischerella the...
WP_008188038 395 TFVQEAEAFSEHFGNSPQGLLKHYSILHLKTLAKQFRWIAFGKAVHQIHKRFGISRKHLLLNHGLKALVpEAINqlw--- 471 Moorea producens
WP_009149817 395 VFAQETKTLAHNFGTSASTLVEIHGIPTLRKLAKQFGWLEFIEAIQQIHRHIGLSRKQLLVQHGLRPIVpDLIKkwv--- 471 Moorea producens
WP_006518642 393 EFAEAIEVASKNYKFSVNYMLTYYGLPALRQLSTQGQWFGFLKAVNYIHHRFQYSRRSLLIRQGIKPIFnKVLHkld--- 469 Leptolyngbya sp...
WP_015205178 394 ALAIQIRGLARSYNESAGKLLWPY------------LWAYGLKPKISNSPVFNL----------GQRLWrVLLRglf--- 448 Crinalium epips...
WP_015192036 391 RLWQEIRGVAKVYNESAWQGFWNY------------FYTYTLS---RSKP---------------IKLWrKIKGklr--- 437 Stanieria cyano...
WP_015116645 392 KLIKELKHREKYTEQSLWSSLSPY------------LWVHALKP--SHRK--------------FIYRVrRKLAkln--- 440 Rivularia sp. P...
WP_019489786 474 lstkrpskqTQISQSNVSQIPIINCDFSKKICLDERIQMMDTSK-QKPLTLREEHRQNLTQGVMAYTLEQMDQYAAMFSL 552 Calothrix sp. P...
WP_010913075 437 ---------PTQMQRGRSWRDLINPDLARRTELIDRFHRAGYMPpGVQASDALSHRWILSNGYVPHSFEVLDKAAANFGV 507 Mesorhizobium j...
WP_006205260 441 ---------RPAAPRGPSWRHLVNPELARRTDLVDRFHRAGHMPsTVSASEALSHRWILSNGVVPHAFEVLDKAAANFGV 511 Mesorhizobium a...
WP_016872084 473 -----qhrqKTSPDWSLPQTPLVNRNFAQRICLDERMQTLSPPR-EAPLTLRQEHWRSLTQGILAYTLEQMDQYAAMFSL 546 Fischerella the...
WP_008188038 472 ------rkwRRQDKSASSVSPLVNRNFAERIGIDQRIQALDKSD-QPSLTVREDHWRNLTQGIFPLILEQLDRYNAAFSL 544 Moorea producens
WP_009149817 472 ------rryQPFQVSGNKSTPLINQEFAERIGLQERLKHWSTPP-YTPLTVRKNQFQALNAGVFTLVLEQIDRCAAAAGI 544 Moorea producens
WP_006518642 470 ------rtpKKSADNLGKAREIVNADFAEQIHLKERVRRYTPKP-VSPGTVRQEHWQSMTGGVMAVNLEAVDRCAAAFGL 542 Leptolyngbya sp...
WP_015205178 449 ------kgsSQSTEQP-TWSKIFNPEFIERIGFSERYRTLQLAQrDAR-TARKEHYHTLNNGLLPFALEVLDKVSGAYGI 520 Crinalium epips...
WP_015192036 438 ------ktfSIQKDLPQSIYSSFNLDFVRRIDLKQREQKLEEIEnSSNQTCQAEHYRILTQGIHAFGLEIFDKAAAAFSL 511 Stanieria cyano...
WP_015116645 441 ------kfrKGKSNTQANTNQIINDKFVERITLKEHLQSLEEKRyKPQPRERDCHYQSLNWGLIPFFLEVIDKSAAAASI 514 Rivularia sp. P...
WP_019489786 553 EARHPFMDKRLIEFCVALPAEQKLFNGYGRMVMRRALEGILPEKVQWRGGKADMSANFDDGFINRNHQILDDVMSNKIQn 632 Calothrix sp. P...
WP_010913075 508 EPRYPFWDKPLVEFCLALPGEEKLSHGFGRYVLRRAMEGILPAAVQWRRDKIDFTANLVNGMVRNHRDLLEQLLVSDAGr 587 Mesorhizobium j...
WP_006205260 512 EPRYPFWDKPLVEFCLALPGEEKLHNGFGRHVLRRAMEGILPPSVQWRRDKIDFKSNLVHGMLGNHRDLVDKVLVSDADr 591 Mesorhizobium a...
WP_016872084 547 EVRHPFMDKRLIEFCLALPSEQKLYQGWGRMVMRRALAGILPKSIQWRTDKADLSPNFNDGFLKRDRQILDQVMSQKMKn 626 Fischerella the...
WP_008188038 545 EARHPFMDKRLLEFCLALPSEQKLYQGWSRMVLRRGMADILPKAVQWRGGKAHMGPNFIHGLLTLNRQVFDDVILNKLEl 624 Moorea producens
WP_009149817 545 EARHPFMDKRLIEFCLALPSEQKLRQGWSRMVMRRALRGSLPEVIQWRGGKGDLSDNFVHGLLEFNRAQLEGIMGTPLEs 624 Moorea producens
WP_006518642 543 EARHPFLDRRLVEFCLAVPSDQKFRRGFGRMIMRQGLNNILPPAVQWRGDKANMTANFVNGLLNINRPLFEQVLNKYSHs 622 Leptolyngbya sp...
WP_015205178 521 ETRYPFWDKRLVEFCLALPAEQKLDQGWSRIVMRRAMTAILPAKVQWRRDKSNFLPNLCHGLLNRDRECLNDLILGDPNs 600 Crinalium epips...
WP_015192036 512 ELRYPFWDKRLVEFCFSLPPEQKLSQGWSRIIMRRAMENILPSEVQWRTSKMDFTPNLVYGLLNQEKRTLKQLIFHNYQi 591 Stanieria cyano...
WP_015116645 515 EANHPLFDKRLVEFCLSLPPEQKIHQGWTRMILRRGMENILPKKVQWRTDKNNFEPAVIHALLDLNRELVEKVILHNSEd 594 Rivularia sp. P...
WP_019489786 633 MYKYVNIDFLQNAYQRLISSENQAQD-----EECTAVWQAVILALWMEY 676 Calothrix sp. PCC 7103
WP_010913075 588 IAPYVNLPQVSAAYARLLSQPDQVAS-----LDVQYVWRSASLSLWLRQ 631 Mesorhizobium japonicum
WP_006205260 592 IAPYVNLPEVSAAYARILRQPDEASL-----PDVQCVWRSIALSLWLRQ 635 Mesorhizobium amorphae
WP_016872084 627 LEKYINLDVLQTAYQRILAAENQASN-----DDWMAVWQAVILASWLDF 670 Fischerella thermalis
WP_008188038 625 IEGYVDTDFLRQVHRRMTSG-GRVRE-----KDCMTVWQGIILALWLDR 667 Moorea producens
WP_009149817 625 INNYVNTNTVQKTYQKLISAKNlt------sQEKMTIWLGASLTLALNK 667 Moorea producens
WP_006518642 623 VLRYVNLDDWENAWHRIKQYPESKKKvssttQDCFMVWRATVLALWFQR 671 Leptolyngbya sp. PCC 7375
WP_015205178 601 LEKYVNITALHEIYHQFIS-QKSLAAp----QDIYTIWKVTSLTLWLQY 644 Crinalium epipsammum
WP_015192036 592 LSNYINTEILQSIYDDQVSSEKSKPDl----KDIRFIWRATSLGLWLNF 636 Stanieria cyanosphaera
WP_015116645 595 VEDYVDMEAVRKIFQKLISERKPS--------DVIPVWVTTLLGYWRSK 635 Rivularia sp. PCC 7116
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap