Conserved Protein Domain Family
rhodolasso

?
NF033534: rhodolasso 
lasso peptide
Members of this family are lasso peptides as found in the genus Rhodothermus. The leader peptide region shows sequence relatedness to several other groups of lasso peptide precursors. Known members of this family have a pair of Cys residues in the core peptide region, suggesting a bicyclic product, with one cross-link from the signature lasso peptide isopeptide bond and the other from the cysteine disulfide bond. This subfamily of lasso peptide appears not to have been discussed in the literature yet.
Statistics
?
PSSM-Id: 411169
Aligned: 3 rows
Threshold Bit Score: 80.3716
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
SHK78958       4 VVKRSWKAPVLVVHGKPQEITASSDGCWFGKQGGQYDADLGPgsLSDCR 52 
GBD00872       2 KAKRTWSAPTLVIHGKVEEVTHQRGPCYLGKQGGKGDVHALT--LSDCH 48 
jgi:Rmar_0969  5 TIKRPWQKPALVMHGKATEVTTGK--CWYGKQGGRYDADLGPgtLSDCR 51 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap