Conserved Protein Domain Family
lone7para_assoc

?
NF033532: lone7para_assoc 
type VII secretion system-associated protein
Members of this family occur almost exclusively in the genus Streptomyces, in the context of type VII secretion systems (T7SS). Several paralogs may accompany a single T7SS. A few members of this family are large proteins with additional domains that add or remove, ADP-ribosylations, suggesting that all family members may have effector activity as well, and that the longer members of the family are multifunctional effector proteins.
Statistics
?
PSSM-Id: 411167
Aligned: 40 rows
Threshold Bit Score: 134.296
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014153542  62 DHWLSVTDRHWLGasdDE-PPPPWAVLGRWRSNARGRI-VSWEANPDYRPSPAAlgwaPPVDDADAALHLAATGYGPDED 139 Streptomyces sp...
WP_015618651   9 ENYFLLMDPDWRPqpgDE-VPPIEAVIGLWPIGVDGSV-GSFRSNPDYEPRDDD----SVTDPLDAMLRLAMQGQVRAEQ 82  Actinoplanes sp...
WP_005152608  40 NSWLYVIDEAFDP---DG-PVPSWAVVGAYPVNGGGEIvEDFHPNDRYRPSPKAlgfpEPRNELEQLLQLVRTNHRPAAD 115 Amycolatopsis a...
WP_020669419  38 NSWLYVIDEAFDP---NG-PVPSWAVVGAYPVNAAGKVvEDFHPNDRYRPSPKAlgfpEPGNELEHLLQLVRTKHRPAED 113 Amycolatopsis n...
WP_005460330  36 GSWLYVIDEAFDP---NG-NVPSWAVIGAYPVNDRGEIvDDFHFNDQYRPSPQAlgfpEPSSELEYLLQLVYTRHRPEED 111 Saccharomonospo...
WP_019809994  40 DSWLYVIDEAFDP---RG-NVPSWAVVGAYPVDAHGEVvDDFHFNDRYRPSPRAlgypDPESDLEHLLQLVRTGHRPAED 115 Saccharomonospo...
WP_017977065  26 DSWLYIVDPSYEG---SGeDVPPEGVVGAFRIDSEGEIeQDFHPNEEYEPRvg---tiEPVNELERVLERISTGQAPESE 99  Actinopolyspora...
WP_010312689  25 DSWLYIADPGYAA---DGeEVPPEGIVGAYRIDADGEIdERFQFNDAYQPSELAanqqEPTNELEHVLARIAAGELPESE 101 Saccharopolyspo...
WP_011875264  26 GTWLYIVDPGYQE---SGdEVPPEGVIGAYRIDDSGEIdEDFQFNDEYVPSEMAvslpEPTNDLEQVLHRIATGQAPESD 102 Saccharopolyspo...
WP_019433954  14 GSWIYAIDPHFDP---SG-RVPPFGIIGAWKADDNGQLtEEFRPNPRYRPSPQArgmkAPTDRLEAAIQLAATGYISDGD 89  Streptomyces
WP_014153542 140 VAEAIAEAgTVAVCVAEDGEPAWTRIPGG-AHAVPVFAPPPGAPADRMPAHVVMTLPALLDRLPSGRDvLLLSPSAPASL 218 Streptomyces sp...
WP_015618651  83 LQVMMRDA-VLSTALNGDGRPLIVKSPDD-VRCVVVATSVAQQRRVSSPEWQQADLMALVSLLPDDVD-VLFNPGGPVPF 159 Actinoplanes sp...
WP_005152608 116 LPRVFLDStLFVYALSPVQRTVIGFHNVDgQVLVPAYTAKALVPRE-WPHARAVLGRDMVPLL-AGHP-VTLNPHDRLTA 192 Amycolatopsis a...
WP_020669419 114 LPNVVLNAtLWVYAMSPIQRTVIGFHNTDgRVMVPAYTSKSLVPKE-WPHARAVLGRDMALLL-GGHP-VAINPHDLVTA 190 Amycolatopsis n...
WP_005460330 112 LAHAVLDAeLYVFAYTPAQRTLVGVHDLDgDVVVPAYTARSLAPRD-WPHARKVRGRDIIDLL-GGCP-LALNPDDVITA 188 Saccharomonospo...
WP_019809994 116 LAPAVLDAtVYVYAYSPDQRTLVGFHDTEgDVVVPAYTGRSLAPRD-WFCVRPVRGRDVVELL-AGHP-LVLNPDDIATA 192 Saccharomonospo...
WP_017977065 100 LPPAVLAAdLVLYAENSEDESLYEAELDDgSRLVPACTSAERVPED-WPSHRVVPGEQLPKLL-AGMD-LGLNLDDPIRA 176 Actinopolyspora...
WP_010312689 102 LPAAVLAAeVLLYAPSADDPMIYTAEMSDgSQLVPACTSASRVPAD-WPGFRRVPGRAVPELL-NGLD-LGLNLNDAIQA 178 Saccharopolyspo...
WP_011875264 103 LPPAVLDAeILLYAEEGEDDAIFAAEMDDgSQLVPACTSESRVPRS-WPGFRRVPGADLPEVL-SGLD-LGLNVDDAIRA 179 Saccharopolyspo...
WP_019433954  90 MQAALLGS---VVYTAPDSPGLRSTEPFT----VAIYTSPVHAPSD-VPEVQRVLFRDVLTGLPDHAV-VKLNPQSPVSA 160 Streptomyces
WP_014153542 219 LLPVDGLRER 228 Streptomyces sp. SID7815
WP_015618651 160 RLTGDFIRET 169 Actinoplanes sp. N902-109
WP_005152608 193 IIPSEHLDKA 202 Amycolatopsis azurea
WP_020669419 191 VVPAEHLLKA 200 Amycolatopsis nigrescens
WP_005460330 189 LVTPEELLHA 198 Saccharomonospora cyanea
WP_019809994 193 VVRAQELVLA 202 Saccharomonospora halophila
WP_017977065 177 VIPYDMLVES 186 Actinopolyspora halophila
WP_010312689 179 VIPHAVLAQA 188 Saccharopolyspora spinosa
WP_011875264 180 IIPHSVLVQA 189 Saccharopolyspora erythraea
WP_019433954 161 EVAVTDIRRT 170 Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap