Conserved Protein Domain Family
lasso_albusnod

?
NF033525: lasso_albusnod 
albusnodin family lasso peptide
Members of this family are lasso peptides in the family of albusnodin, and appear limited so far to the Actinobacteria. Members are more strongly conserved in the core peptide region than in the leader peptide region, which is unusual for ribosomally produced, post-translationally modified natural products. The founding member of this family is not only circularized by the formation of an isopeptide bond, but also acetylated.
Statistics
?
PSSM-Id: 411162
Aligned: 37 rows
Threshold Bit Score: 48.3904
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_017574745   4 MEEPPEETPTVIDLGDAAALTQGSDDQSVESKQSPYD 40  Nocardiopsis kunsanensis
WP_017605499   1 MEEARDEAPVVIDLGDATVLTQGSDDQSVESKQSPYD 37  Nocardiopsis alkaliphila
WP_018539562   2 KPAQVDDQPDVINLGDAATLTRGGEDQGVENKRAPYD 38  unclassified Streptomyces
EDX26975       6 KASDPDENEEIVPLGDAAALTKGSTSESIENKRSPYS 42  Streptomyces sp. Mg1
WP_017576554   6 IPVPLDTDESVIDLGDAADLTLGEGSARNENKRNPYN 42  Nocardiopsis kunsanensis
jgi:Ndas_4485  6 AEDQETHEELLVELGDAADLTLGQGRAQNENKRNPYN 42  Nocardiopsis dassonvillei subsp. dassonvillei DSM 43111
WP_017573784   6 AEDQETHEELLVELGDAAELTLGQGRAQNENKRNPYN 42  Nocardiopsis halotolerans
SDC20594       6 SAEMV-GSGQLVDLGDMAALTLGSGRSTQEAKRHIYN 41  Alloactinosynnema iranicum
WP_017613395   5 SPSAVESEEMVVDLGDAADLTLGEGQSENEDKRKIYN 41  Nocardiopsis salina
OLL89730       1 --msqHNETEMVELGDAAVLTEGGGSGTSEDKRYVYA 35  Pseudonocardia sp. Ae331_Ps2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap