Conserved Protein Domain Family
lasso_peptidase

?
NF033523: lasso_peptidase 
Atxe2 family lasso peptide isopeptidase
Statistics
?
PSSM-Id: 411160
Aligned: 115 rows
Threshold Bit Score: 537.186
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
PCI53373             51 ITIDDLSSIRDIKSKTLSPDGKYIAFQTIQAHKDTNNFIVGWYIAAIKQNAKPIKIAESAQAQpngn-ggfdGSDIIWSP 129 Alphapro...
WP_082394156         30 VSPRQLVEVSDLGELAVSPDGSHVAFRLQRASVERNTHDTAWYVQRMDASAPARRVGEGGQLLresdgaslaPAGVAWSP 109 Stenotro...
WP_097122946         40 ISPKRLLEVADIVGPVVSPDGRHVAFRVEQASIEHNRYDTFWYIQDVDGSAPPRRIADGGTPLrdystglsiPAIPIWAH 119 Pseudoxa...
WP_027490317         51 ISPRRLLEVTDLGNPVISPDGRYVAFRAEQASIERNTYDTTWYVQGLDGQSPPRRVSDGGVPLreyvsglvlPSPAVWSP 130 Rhodanob...
WP_077513130         32 T-IRQLVEVVDIKNVSVSPDGRLVAFRTEQASIERNTYETVWYVQPVDGTSAPRRLGDGGEMLpdgg-gsskPELPVWSP 109 Rhodanob...
ATSB10:ATSB10_15080  37 VSIRQLVEVVDIGSVSASPDGRWVAFRTERASVERNTYDTAWYVQPVDGSGPPRRLGEGGAPLrttg-glsaRAPVLWSP 115 Dyella t...
WP_081760174         29 VTSRQLVEVVDFTGISTSPDGKLVAFRADRASVDRNVYDTVWYVQPIWSSAPPRRLGEAGPAMhdag-gevpNEPAQWSP 107 Pseudoxa...
WP_079640276         17 TSPRAIAEIADISGLATSPDGAWVVYRIERPSTVTNSIDVDWYIVRADGAQPPRALGRTGTAMwdda-gtvlPGEAQWAP 95  Sphingop...
WP_095388861         23 VGAADLVEVSEISGPTLSPDGERFAFRVSRASLESNAITLEWYVGSVDGP-PQLAASGG--SArvdgaglvsDQTPIWDK 99  Sphingop...
WP_062179262         22 VAATDLVEVAEIGGPTISPDGTHIVFRVSRPSLETNETSLTWYIGAVDGSEPEFAADGG--LAridgaglvaDQTPVWDP 99  Sphingop...
PCI53373            130 DSKWIYFTKKHEGAVQIWRSSREHPEQQQITNNAGDIQSLDISRDGSKVIFNIGRTRSEITALKRKLSEQGFLHQQPILY 209 Alphapro...
WP_082394156        110 DGRFIYYRALLDGRVAVWRARADGSDARALTRDPADVRRFRLAADGRSLRYSVGATRQQVRDAEQAEYDRGIHIDQTVPL 189 Stenotro...
WP_097122946        120 DGHAIFYRALFDGKAEVWRAAADGSGAAPMTSDPADIRDFELGRGGAVLRYSVGATREEIIAAEQAEYDSGVHIDDTVFV 199 Pseudoxa...
WP_027490317        131 DGRWIYYRARLDGRVSVWRAAADGSGARAMTSDPADVRDFALSGDGQTLRYSVGATREEVIAAEESEYDHGIHVDDTVVI 210 Rhodanob...
WP_077513130        110 DGKWIFFRAVHDARIEVWRAAADGSRTEQLTYGTANVRTFSLNPDGSVLYYSVGATRETVIDAELAEYDRGVHIDRTVML 189 Rhodanob...
ATSB10:ATSB10_15080 116 DGRWIFYRAVFAGRVEVWRAAVDGSRTEPVVQDPANVRQFSLSADGSALTYSVGATREAVRDAERAEYDRGVHIDRTVPL 195 Dyella t...
WP_081760174        108 DGRWIYYRALLDGRVDVWRAAVDGGRTERVTRDPANVRSFVLSGDGTTLFYSVGATREEVGDAELDEYDHGVHIDRSVPL 187 Pseudoxa...
WP_079640276         96 DSRSIVVRALVDGCVGLWESKIDGSGFHKIVVSDGDIEAFAILPDGVVVAR-EGPPRAAIARAEEDERERGILADGHVDL 174 Sphingop...
WP_095388861        100 DSKGFRFLAFRDGEVTLWHWRDDGGAKMEVR-NDADILDFAVSDDGGLLRYTVGATRAEISRAQTAAYEGGVLVDARVDL 178 Sphingop...
WP_062179262        100 DSRGFRFLAYHAGAISLWHWRKGAGAREEIR-EDADIVEFALSADGKSLRYTVGATRAQIEQAEMKAYEEGVLVDAAVDL 178 Sphingop...
PCI53373            210 slRFDaNIAQCTDGRKRYSEVTEIHScqlsywifetdsgvereateveiSRRLVRADTTRERRNKGWLVGEERQMQ-RFS 288 Alphapro...
WP_082394156        190 --GQP-LFRSGYLDRRGSTQRLLGSDv----------------------IRSPLLAGAGDRWREIALATGQVRDVAgEDT 244 Stenotro...
WP_097122946        200 --GAG-LFRSSQLQGRAATQRFMGPWf----------------------EPGPLLGKRGSRWKELDLETLEVRDVGsSEA 254 Pseudoxa...
WP_027490317        211 --AAG-LFRSSKLDGRPTTQRFLGDWf----------------------STGPLLAKVPDRWKAVDLTAMTTHDLSaSEP 265 Rhodanob...
WP_077513130        190 --GEA-LFRSGFQGGRLATQRLKGg------------------------VRLPLLSGVPDHWKALELSTGVTTELAsGRY 242 Rhodanob...
ATSB10:ATSB10_15080 196 --GDD-LYRSGFHEGRLATQRLVDNEl----------------------ERFPLLHQEPDHWKAVDLATGVIHALAaDAL 250 Dyella t...
WP_081760174        188 --GDS-LFRSGYHEGRLATQRLVDNEv----------------------MGSQLLSQTPERWKVVDLRTGTTREMDaKQV 242 Pseudoxa...
WP_079640276        175 --ASP-LYRGSLVNGRPSTQRFTEDWf----------------------ERRPLLSNVPRTVRAYELESGTVRAATeAEA 229 Sphingop...
WP_095388861        179 --NQA-IAGGVIEDGKRVMQRFSGPWf----------------------DRKSLLWDAPRREIFVPSVGATPHSAPnDQF 233 Sphingop...
WP_062179262        179 --NQA-IAGGVIDDGKRIMQRFTGPWf----------------------DRRRILWDAPRREKAVQLQPAATPLSGsLKT 233 Sphingop...
PCI53373            289 ADGAQLAWIENKDSEVYKGLFPQMILKVSRdg---------------------------kEVICPATECISQRKVgfrgI 341 Alphapro...
WP_082394156        245 ---ASAAPPGWVAAF-TPWKLAWDAHAGRAamlvhvggyqsvgpr-pevelvvatgkgkrPLRCRDALCTGQPITs---V 316 Stenotro...
WP_097122946        255 PGQAPSTLGLPEHL--TPWKWAQNPDDERIalltrvgdaagrfskpdvelaiapsaragqVVTCQDPLCAGRNITa---L 329 Pseudoxa...
WP_027490317        266 PAHTLIAADLSPDLPAAPTKIALNSGDGRIavlmpgrtekglllsrdvelamlpdrhasrPIRCMAELCRHRHISd---I 342 Rhodanob...
WP_077513130        243 PESPVTAANLPPAGG-EIVRVAEDRGSKRIavlreqsdqqgragqrsvalsmlpsiksgrLVKCTAEPCTGKQVTd---I 318 Rhodanob...
ATSB10:ATSB10_15080 251 PAKSAVTAGFPKRFG-KIVAVAEDHGSGHFallvrpghegreaersspelamlhtkasrrLTRCTAAPCVGKPITn---I 326 Dyella t...
WP_081760174        243 PARGPARIELPQDLG-SAVKVAEA-GDGRIaflaragerrtgae--gptlgvlgrrktgkPILCVATACARTRITe---I 315 Pseudoxa...
WP_079640276        230 ASldaapeapls---------------------------------------artsgvlqaNNVCLDPSLCGDDELr---L 267 Sphingop...
WP_095388861        234 SLHSASQRPWAAAPDGSKAEILRKAGSASLvvtr----------------------pggeRIQCEAEFCRSPKLLa---T 288 Sphingop...
WP_062179262        234 ETRTPSQGVSVASDDGSVATVKRAAKRTTLtvtr----------------------kngaTILCAAPICQSPGLLv---T 288 Sphingop...
PCI53373            342 WWHPNGREIIFHVIDGPHNSLNSFYAWVPGEVSvrLILRTDDYFgigy-----yghpCDLAGEKLVCARSTSTSPTEIAS 416 Alphapro...
WP_082394156        317 QWRPGHDEVVFTLTDPDDSQAQSIFRWDITTGRvvPVVHTPGLVnggra----apggCGASAAALVCVAADARHPPRLER 392 Stenotro...
WP_097122946        330 QWRPGHDEVLFTVTDRREGRAQSIYRWDVKRGVvdFVVRSRGLLggdstqqrfqdvpCGVSADALVCVTAEADRPPRLEA 409 Pseudoxa...
WP_027490317        343 QWRSGSDEILFTATDYDQGRAQSIYGWNVSTGTvrPIVISNGLVsgsqr---ywdipCALSVDTLVCVAAEADRPPRLEA 419 Rhodanob...
WP_077513130        319 AWRPGSDEILFTVSERDSELEQSIFRWNVVTGDvqPVVRSRGQItgggr---wgpepCAASASALVCVAAEADVPPRLER 395 Rhodanob...
ATSB10:ATSB10_15080 327 VWRPGGAEVVFTVTAPDN--RQSIFRWKVASGAvvPVVASSGQVggggr---wepgsCGVSPDALVCVTARADRPPRLER 401 Dyella t...
WP_081760174        316 TWRPERDEVVFTVT--DEAMGQALYRWNVADGTvhAVAASRGQLggggr---wdtgaCAASPDALVCVAADPDRPPRLER 390 Pseudoxa...
WP_079640276        268 SAQASLPDGSTVFTLRDRSYRQSIYRLPAGQTDlrLLIASPGLLsggrd----drtpCATTPMALICVEASPSVPPRLVR 343 Sphingop...
WP_095388861        289 TWLPNQDILLAFVDEGSA--REAVWLWKVGAATarKVAITDGALrlad-----rpsrCAVTMRALICAESMPLIPPRLVR 361 Sphingop...
WP_062179262        289 AWRPGRDALLLFHDAGSA--REDVWEWSVGSRTarKIVTTDGALrltd-----rplrCAVARDALLCAESQPLIPPRLVR 361 Sphingop...
PCI53373            417 IHL-GSGKISTIVDVNPEFND-LRFTKVEKILGEDNYGHNVYAHLVYPEGYIKGQRYPLVISSYNSYGFLRGNE--EQPI 492 Alphapro...
WP_082394156        393 IDLeSGARQVLFDPNAALAAEmAHVP-VQRLHWQDATGRRFNGLYFPAR-RAGHGRPPLFLTYYRCTGFVRGGVgdEWPL 470 Stenotro...
WP_097122946        410 IDIeTGRRTPLFEPNAVLASDiAATVPAELFRWQDEHGEEFSGWLFAAPGAER---APLFVTYYSCEGFLRGGVgdEWPL 486 Pseudoxa...
WP_027490317        420 IDVaSGHKRILFQPNMGLEADiAATVPARLIRWKDKQGREFTGQLFEAHGARAGHPPPLFVTFYNCYGFLRGGLgdEWPL 499 Rhodanob...
WP_077513130        396 IDLeSGSRTVLFAPNQVLAQDmKKFVRVQFVTWTDAQGRRYTGQFYPST-ARDGRPPPLFIVYYRCTGFLRGSVgdEWPL 474 Rhodanob...
ATSB10:ATSB10_15080 402 IELdSGKRDVLFDPNEALAHNmAQSVPVREIHWVDAQGTRFSGQFYPAK-PQGHKPPPLFIAYYRCSGFLRGGVgdEWPL 480 Dyella t...
WP_081760174        391 VDLeSGERRILFDPNIDLTIDlAETVTVESAVWKDREGRNYTGQLYRPL-ERVGEPAPLFVAYYRCAGFIRGGMgdEWPM 469 Pseudoxa...
WP_079640276        344 IGLn-GQQTIIHTPN---HFPdSDGLLAETIVWQ-VGGSRASGVLIRPKIPGR---LPLFITYYRCPGFVRGGLgdEYPL 415 Sphingop...
WP_095388861        362 IDLaTGQRRPLFEP--NSALAaRIDAEAKSLELPGG----YSAILLSPP--RAKAP-PVVVQNYHCAGFLKGGTgeELPM 432 Sphingop...
WP_062179262        362 IALaGAKHSVVFEP--NAALArRVRAEAIPLALPGN----RSAILLRPA--GTKTPTPVVVQNYHCAGFLKGGTgdELPM 433 Sphingop...
PCI53373            493 HAYAQNGIAVLSFDyggrhtdyvkkinikRYSKaFNHDVFVNQGS-VTAIEKMVENLIDRGIVDSRKIGISGISHGSVIL 571 Alphapro...
WP_082394156        471 ATLADRGISALCIN----------------APP-SVQDAVTRFETgRLAIESVIDLLSSRGEIDRDSVGMGGLSYGTEVT 533 Stenotro...
WP_097122946        487 MTLAGHGISALCIN----------------ANPgY-LDVVRYYDQgLSAVKGAVDALAAHGRIDPSRVGMGGLSYGSEVT 549 Pseudoxa...
WP_027490317        500 ATLAEQGISALCIN----------------AIPeFRIDFVARHDQgRAAVESVVKPLSAEGRVDRARVGMGGLSYGSEVT 563 Rhodanob...
WP_077513130        475 ATFARSGIAALCIN----------------AAP-LSDDAIARYQQgLSAVEGAVTLLAKQGAIDSTRVGMGGLSFGSEVA 537 Rhodanob...
ATSB10:ATSB10_15080 481 APLALHGISALCIN----------------APP-TPSDAVKRYRQgQSAVESAVAYLGSRGDIDPDRVGMGGLSFGAEVA 543 Dyella t...
WP_081760174        470 ATLAKHGIAALCIN----------------SAP-FDEDALARFRHaQAAVESAVEHLASLGYVDPARVGLGGLSFGAEVS 532 Pseudoxa...
WP_079640276        416 HALAAHGIASLCIN-----------------VQpHGDTVGERYEIgLETIKAAISDLDRRELVDPARVGMGGLSFGSEVT 478 Sphingop...
WP_095388861        433 LPLAEHGIAVLCID---------------PFRGpPGSGTDGTYELaRTVIASAIADLGQRKLVDPNRVGIAGFSHSSGVA 497 Sphingop...
WP_062179262        434 LPLVEHGIAVLCID---------------PFRGpPRGGQEGTYELaRTVIAAAIEDLAKEGLVDPNKVGIAGFSHSSGVA 498 Sphingop...
PCI53373            572 TNSILRQ-NYAAASTAEIFSIPTYFKKSSSSARGK-SYDETFGKITSSEG--QAMRRKFSLAANAQSIDTPILSQVSDQE 647 Alphapro...
WP_082394156        534 LWMAMNTdRLAAASVSSIAFSPLAYTLMSLSGDTFfSR-LRTYWQLGDPEttAAQWKRLSPVFNLQRIDVPVLMQLPEQE 612 Stenotro...
WP_097122946        550 MWTLMRSgLLSAASITSPSLTPNWYLFNSLR-EGFrTG-VKSNWQLGPLDetPERWRMMSPVFNLDSIRAPILFQMPEQE 627 Pseudoxa...
WP_027490317        564 LWTLAHSdVVSAASVSSMSVTPTYYLFNSLR-GAFrSN-LLKLWQLGAPDetPERWREISPVYQLGRIKAPILFQMIEQE 641 Rhodanob...
WP_077513130        538 VWTAMHSdLLRAISVSSPVVTPMGSLMMSLGGEEEhSR-MRRYWQLGTLEetPDHWRQLSPTYHIERMRAPVLMQMPEQE 616 Rhodanob...
ATSB10:ATSB10_15080 544 MWNAMYSrVPRAISVSTPVVSPMARTLFGLWGDVYaSR-LKRFWQLGSPKetPERWRLLSPYYDVGRIKVPVLMQMSEQE 622 Dyella t...
WP_081760174        533 LWMAVNStVPRAISVSTPVVSPLMHLLMSPWEETHrSR-LRRYWQLGG-TetLERWREISPVLDPEQVRAPVLMQMSEQE 610 Pseudoxa...
WP_079640276        479 MWTASHSqILKAAAISSVHVTPSYYWFNARPGRENfARNLERYWKLGPPDqdIARWKQMSSSADITAISAPILMQLPENE 558 Sphingop...
WP_095388861        498 LWAVRHStNFKAATIGTGQISPHYFWTNAVPDRGFeAM-LKDYWSIGDPDadPARWRLASAVHNVEAINTPILMQLPDAE 576 Sphingop...
WP_062179262        499 LWALRHSkAFAAATIGTGQISPHYFWTNAVPDRGFaAT-LEDYWRMGDPDsdPARWKIASAVYDIAAIDTPILMQLPDAE 577 Sphingop...
PCI53373            648 FRFSEVDYNALLDAGKPIEMYVYPDERHIKWQPAHKYMVYRRNVDWFNFWLQ 699 Alphaproteobacteria bacterium
WP_082394156        613 YLHTLDYAVPLIRDAR-ADLYVYPNEAHQKFQPRHKLAVYERNLDWFRFWLQ 663 Stenotrophomonas acidaminiphila
WP_097122946        628 YLLAVEYALPLVRMKR-ADMYVFPDEPHIKFKPKHKLAAYERNVDWFRFWLQ 678 Pseudoxanthomonas wuyuanensis
WP_027490317        642 YRMALDYALPLVRRHQ-ADVYVFPDEPHIKFQPRHKLAVYERNVDWFRFWLQ 692 Rhodanobacter sp. OR92
WP_077513130        617 FRYALDFIVPLIRRHR-ADLYVFPDEQHQKSQPRHKLAVYDRNLDWFRFWLQ 667 Rhodanobacter sp. B05
ATSB10:ATSB10_15080 623 YRSGLDYMVPLIREHR-ADVYVFPNEPHQKFQPRHKLAVYQRNLDWFRFWLL 673 Dyella thiooxydans
WP_081760174        611 YRYSLDYAVPLMRMDK-ADLYVFPHEKHQKTMPRHKLAVYERNLDWFRFWLL 661 Pseudoxanthomonas suwonensis
WP_079640276        559 MRQSIELVSKLATAHM-GELHVFPLAPHIKVEPRQKLAVYERNLDWFRFWLK 609 Sphingopyxis flava
WP_095388861        577 AAWTAELHTKLKRAGKPAEMVVYPDELHNKYQLRHKRAVYERNLDWFRFWLT 628 Sphingopyxis sp. GW247-27LB
WP_062179262        578 APWTAEFHTKLKRAGKPAEMIVYADELHNKYQPRHKRAVYDRNLDWFRFWLT 629 Sphingopyxis sp. C-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap