Conserved Protein Domain Family
transpos_IS3

?
NF033516: transpos_IS3 
IS3 family transposase
Statistics
?
PSSM-Id: 411153
Aligned: 203 rows
Threshold Bit Score: 225.135
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_012218041  63 EQKNLALEH-YV---NHGRSFSFTLRALGYPCRQiLTAWVrERYpetrkrvvgkagrpavslATRQlAVYe---LC---- 131 Burkholderia
WP_076611214  67 EEKLAIVIEsAS---LTEVELGEYCRRKGLYPEQ-IAGWK-NGF------------------VLG--SSAp---LN---- 114 Geobacter urani...
WP_076611176  34 KYKLDILNQ-VDsctKPG-SLAALLRREGLYASN-LNTWR-RQRd-----------------EGSLaALTpkqrGR---- 88  Geobacter urani...
WP_076611568   7 EMKKKIVTA-NI---QDGRTIASLATEYGVSTAS-INNWI-RDYr-----------------KECQaTPEamse------ 57  Erysipelothrix ...
WP_076612240  15 AFKLSVVAQ-VE---KGELTYKEAQRRYGIQGRStVLVWL-RRH------------------GLQDwADPs---GRaqsg 68  Burkholderia ce...
WP_076612157  15 AFKLAVVDQ-VE---KGELTYKQAQDKYGIQGCStVLVWL-RKH------------------GKLDwSLGt---PP---- 64  Shewanella
WP_076611657  15 SFKIAVVEQ-VE---KGEMTYKQAQQRYGIQGRStVLVWL-RKY------------------GRLDwRPGl---PD---- 64  Salmonella ente...
WP_076612161  19 GFKLQVVAA-VE---KGDMTYKQAQTTYGIQGRStVLTWL-RKH------------------GKMDwTQP----VR---- 67  Shewanella peal...
WP_076611530  19 GFKLAVVSQ-VE---KGELTYKQAQDHYGIQGRStVLTWL-RKH------------------GRLDwSQP---------- 65  Shewanella peal...
WP_014620664  19 AFKLGVVER-VE---KGEMTYKQAQTRFGIQGKTtVLVWL-RKH------------------GKLDwSKL---------- 65  Shewanella baltica
WP_012218041 132 TREGsaqavaqkldvdrvslynwknqllgrgapasmkrdkgspsetdrDELErqvEE----LRRDIRNLKLEHDLLKKAn 207 Burkholderia
WP_076611214 115 KAEReqmreqt-------------------------------atikqlEKEL---NRkdkaLAETAALLILQKKVP-GAl 159 Geobacter urani...
WP_076611176  89 -KALkpdpma--------------------------------venerlRKEI---TR----LAKRLKQAELIIDVQKKSl 128 Geobacter urani...
WP_076611568  58 ---------------------------------------------lelMEEN---RK----LKQKLAEFEKKMTFK-KG- 83  Erysipelothrix ...
WP_076612240  69 STMPkpdsk-----------------------------------pltpEQRI---KE----LETQLREAQEKAALF-EAv 105 Burkholderia ce...
WP_076612157  65 TSMRgqlmte--------------------------------pttltpEQKI---KA----LEAELEDTRMKAAFFEAIv 105 Shewanella
WP_076611657  65 LVKRklpvaqt-------------------------------tipltpEQRI---RE----LEEQLELANQKAEFFESVi 106 Salmonella ente...
WP_076612161  68 MTMPkttka-----------------------------------ketpAQKI---KR----LEKELEDEHLRNLLLNEAv 105 Shewanella peal...
WP_076611530  66 IEHSpmsks-----------------------------------ketpAQKI---KR----LEKQVSNLEMKNMIYGDMv 103 Shewanella peal...
WP_014620664  66 FQHPlmphs-----------------------------------ketpAETI---KR----LERELAEAKLRNQIL-NGm 102 Shewanella baltica
WP_012218041 208 elvkKD-LGVdlsllsNREK---T-TLVD-ALREeYGLTELLERLDLARSSYFyh---rsPI--------RVA----Dk- 265 Burkholderia
WP_076611214 160 g--gARgRKI------DLPArqeLiALIDeACAGgARLGRACEAVLLSPRTVQrwh-lpdEIpsdgrkaaSRDra-pAnk 229 Geobacter urani...
WP_076611176 129 adpgDH-LGY------AARErerLmEAVEiLAPD-VGTDPACKALGVSRAGLYrrraiskTAprvpqkrpVPPrtlpS-- 198 Geobacter urani...
WP_076611568  84 ----SS-ILReg---nRQVI---Y-KFID-QHKShFGLRWLLKRCGVYANGYYny---lrNTk-------RDYh--qS-- 136 Erysipelothrix ...
WP_076612240 106 ldvmRKdYGI------TVKKa--FgVVAQkRIEK-LSVERACRYMGISRQAYYkr---crSEq-------CRCs------ 160 Burkholderia ce...
WP_076612157 106 eklrTDyGIS------VVKKa-tReTLQE-KTAIgYGVTQCCRYLGISRQAYYqq---cqRQ--------IVSe--lK-- 162 Shewanella
WP_076611657 107 nvlkNDyGVS------VVKKa-aRqVLTQ-SQAPkITVTRACQFLGHSRQAWYqy---ntRC--------NKRq--eH-- 163 Salmonella ente...
WP_076612161 106 diidAEyGAG------LRKKvlsQgARSLqKQKV-TSLNRACKLLGITRQAIYqr---erRAn-------CRAm------ 162 Shewanella peal...
WP_076611530 104 ellkNEyGID------LEKKvlsRtLWFA-KVKGtIKLATASRQFNLSRQAIYqw---kqRRt-------AKA------- 159 Shewanella peal...
WP_014620664 103 vdimDNeYGA------GLRKkvlIrYLWQaKTQSkINLAVACRAVGISRQGIYqa---vaRM--------ASRsa-eL-- 162 Shewanella baltica
WP_012218041 266 -Y--ADVRRTVA-EIFEDnHR--SYGYRRVQAALsR-----QR--V-FLSEKVVRRLMKQ-GGLHA-ARPKRRRYRSy-- 327 Burkholderia
WP_076611214 230 lS--ETERVTIL-ATANQ-EKfaSLPPSQIVPKL-Ad----DG--IfLASESTFYRTLRA-EKQLAhRGRTKAARHKr-- 295 Geobacter urani...
WP_076611176 199 -EerQAVLDILHsERFQD--K----APHEVYATL-Ld----EGayH--CSIRTMYRILEE-NAEVKeRRNQLRH------ 257 Geobacter urani...
WP_076611568 137 -K--QAIKNKIK-DIFHS-TGg-IVCHRGMVIFL-Ar----DD--I-KLSKTTVHKYMNKeLQLYCiPAKKRPRYV---- 198 Erysipelothrix ...
WP_076612240 161 qA--ETVATLVR-DVRLR-QP--RLGTRKLHHLL-GpalveRG--I-KLGRDRLFDVLRA-ARLLVvPHRAYHK-TTq-- 226 Burkholderia ce...
WP_076612157 163 -E--QEVVQTVQ-Y-ERL-FQp-RVGTRKLQYLL-Nkm--hQI--V--IGRDRLFRCLRA-HRLLVtPKRAYHK-TTh-- 224 Shewanella
WP_076611657 164 -H--AQVLDFVA-R-TRC-RQp-RIGTRKLHYLLnm---qaDK--TlNIGRDRLFNLLGE-YRLLVpVKRAYHKTTN--- 227 Salmonella ente...
WP_076612161 163 eL--APVRAMIL-DIRRF-MP--RIGGKKLYFLL-KpkfieKG--I-KLGRDNFFSYLKS-EGLLVkPKRNYTKTTN--- 228 Shewanella peal...
WP_076611530 160 -EtlKPVMKMVM--YWRQfMP--RVGTRKLYQLI-KpqlieQG--I-KLGRDGLFQYLKQ-QNMLVkPRKNYTKTTN--- 226 Shewanella peal...
WP_014620664 163 ----SVIKDWVQ-Y-WRNyMP--RLGTRKLYTLI-QpklveHD--I-KLGRDGFFTYLRS-EGLLV---KPKRSFTKttf 226 Shewanella baltica
WP_012218041 328 IGEISPApdniin---rdfhanAPNEKWVTDISEFQIPA-G--KVYLSPMIDCFDGMVVSWSIGTSPDAELVNSMLDAAI 401 Burkholderia
WP_076611214 296 PDAVLAT---------------EPNQLWSWDITYLSTTVkGl-YFYLYLIMDVFSRKIVGWEVYAEESADHAAITLRKAY 359 Geobacter urani...
WP_076611176 258 PDYKKPEll-----------atAPNQVWSWDITKLMGPA-KwsYFYLYVILDIFSRYVVGWMVATCESSELAKRLFKETC 325 Geobacter urani...
WP_076611568 199 EGTKHEIfpnhls---qdfdieEKNTVWCTDFTYIKGWD-Gk-FQYNCSILDLSDRSIVATKTSRMMTSELAKETLETAL 273 Erysipelothrix ...
WP_076612240 227 SHHRFRRhpnllkpgpdqivptGPEQVWVADITYLPTAG-P--FVYLSLVTDAFSRKIVGHHVHESLQTEQVSQALKKAL 303 Burkholderia ce...
WP_076612157 225 SHHRFRChpnllkpseqqvdisRSEQVWVADITYLSLQD-N--EAYLSLVTDAWSRKIVGYHVDDNLKTDGVLTAYKRAL 301 Shewanella
WP_076611657 228 SHHRFYRhpnllkpgpeqvtalEPEQVWVADITYLPLRS-G--TAYLSLVTDACSRKIVGYHVGENLQTENVVKAFRQAL 304 Salmonella ente...
WP_076612161 229 SKHWMKKhpnllk----elvptAPEEVFVSDITYVQSEQ-G--IHYLSLVTDAFSRKIMGYELSNEMKATDVVKALEMTI 301 Shewanella peal...
WP_076611530 227 SHHWLRKypnllk----dravkRVEEVLVSDITYVKSDE-G--THYLSLVTDAYSRKIMGYELSHEMKACDVVKALNMTI 299 Shewanella peal...
WP_014620664 227 SKHWMKKhpnllk----eeglhDVEHVLVSDITYLESDQ-G--VHYLSLVTDAASRKIVGHHLSSDMKAESVVKALKMAV 299 Shewanella baltica
WP_012218041 402 ----E--TV-TEddetPIVHSDRGGHYRWPGWLSRVAKAKLIRSMSRKACSPDNAACEGFFGRLKTEM-FYPGDWRstTI 473 Burkholderia
WP_076611214 360 lregV--AG-RT----LILHSDNGSPMKGATMLGTMQKLGVMPSFSRPSVSNDNPYSESLFKTLKYHPgLPEKPFD--TL 430 Geobacter urani...
WP_076611176 326 ekqvI--QK-GQ----LTIHADRGSSMKSKPVAFLFADLGITKTHSRPYTSDDNPYSEAQFKTLKYQPdFPE-RFG--SI 395 Geobacter urani...
WP_076611568 274 s---S--QKkRPk--gLILHSDQGSQFASYDFTEYCLKNNIKQSMSKAGCPYDNAVMERFFRTMKFEL-INRFQFD--ND 343 Erysipelothrix ...
WP_076612240 304 r---RrqTR-QP----LIHHSDRGVQYCATYYQDIHRRHGLRCSMTDGYDCYQNALAERVNGILKGEF-LLQ-RPA--DL 371 Burkholderia ce...
WP_076612157 302 r--qRqdKS-KP----LIHHSDRGIQYCSNAYQAVHAQHGVTCSMTDGYDCYQNALAERVNGILKQEF-LTH-KPA--TL 370 Shewanella
WP_076611657 305 -------RR-RKttgpLVHHSDRGLQYCSVLYQSVHERNGITCSMTDGYDCYQNALAERINGILKNEF-LLS-RPA--DL 372 Salmonella ente...
WP_076612161 302 -------SN-RQyqhrAVHHSDRGLQYCSAVYQLALQRSDIRASMTDGYDCYQNALAERINGILKQEF-LLS-PCC--NL 369 Shewanella peal...
WP_076611530 300 -------KN-RQttgdAIHHSDRGMQYCSAEYQETLAANGITPSMTDGYDCYQNALAERVNGILKHEF-LLY-RCR--TM 367 Shewanella peal...
WP_014620664 300 -------KD-KRysanAVHHSDRGSQYCSAVYQDKLQANHIQPSMTDGYDCYQNTLAERVNGILKQEF-LLY-RCK--TL 367 Shewanella baltica
WP_012218041 474 AEFVEVLDAYVR-WYNEKRIKGSLGYLSPIEYR 505 Burkholderia
WP_076611214 431 DEARHWVAGFQH-WYNEEHQHSAIKFVTPGQRH 462 Geobacter uraniireducens
WP_076611176 396 EDARSFCQTFFP-WYNQEHKHSGISLLTPEVVH 427 Geobacter uraniireducens
WP_076611568 344 KQLETAISEYVFgWYNQVRPHASNGYKTPNEIR 376 Erysipelothrix rhusiopathiae
WP_076612240 372 EQAAKMVEQSIR-IYNHERPHAALKYKTPDAVH 403 Burkholderia cenocepacia
WP_076612157 371 EEARQMVAEAVA-IYNQRRPHLALKYKTPDEVH 402 Shewanella
WP_076611657 373 EQAREIVKESVA-IYNHERPHQALKYKTPDDVH 404 Salmonella enterica
WP_076612161 370 NELKQLVEESIF-IYNELRPHLSLGMKTPNQVH 401 Shewanella pealeana
WP_076611530 368 KELDMLIKESIE-TYNHLRPHLSLGMKTPNEVH 399 Shewanella pealeana
WP_014620664 368 EELKRLVRESIA-IYNEMRPHLSLDMETPNQVH 399 Shewanella baltica
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap