Conserved Protein Domain Family
LarB

?
NF033503: LarB 
nickel pincer cofactor biosynthesis protein LarB
This protein, related to AIR carboxylase, is part of a three protein system involved in producing a specialized nicotinic acid-derived, nickel-containing cofactor, as used in the nickel-dependent lactate racemase of lactic acid bacteria.
Statistics
?
PSSM-Id: 468048
Aligned: 105 rows
Threshold Bit Score: -1
Created: 24-Apr-2023
Updated: 3-May-2023
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_004032832     36 FDKSRSSRTGFPEAVFSPSKDYGDLLLIINNYFTSENpeNLIVTKLSsERYEKLADDLDlEgfeLDYNKRAQILVIRNR- 114 Methanobrevi...
WP_005661208     40 LDHHRALRRGVPEIIYCPGKSDEQLRAIATALDGRKG--TFIFSRINaFQVDLIRSIFP-D---LVHHEKARIAARVDE- 112 Dethiosulfov...
WP_008521251     40 LDVHRSLRRGFGEIIYSQSKSDEQLQKIAQAVKDGAE--PCLFSRLCeRQASLVRAVCP-D---LEYCQEARLGGLRRP- 112 Jonquetella
WP_006768366     15 LDLDRVRRRGYPEAIYCESKTVEQVAAIAASLREVDQ--TTLFTRANpDHAAAVMEVLD-D---VFYDPVAGFLAYPAA- 87  Corynebacter...
6_ncbifamImport   1 LDMQRMARTGMGEVVLAEGKDDERLLHAVTILAAEGP---VLVTRVGeAQGRLLSAQLP-D---GEWWPEAGIFAVSPPr 73 
WP_007945019      5 YDYQRRERLGMPEAIFCEGKDVDSLDRIIEELAGSPEh-PVLFTRLQqAQFNQLTPTLAaL---LDYDSLSATGVLHGA- 79  Pseudomonas ...
WP_007618724      6 WDKDRKARTGIAEAVFCLHKSAQDLHPIIRFNIENST--PVLLTRLSqQQWLALPLELQnA---LDYDECSETAIINGS- 79  Paraglacieco...
WP_005028965     37 FDHARTARIGLPEAVFCEGKPFEALVELLSRFGRGSGh-PVLFTRLApDVFARVPAEIRaG---YDYHPLSRTAFGDAL- 111 Bilophila wa...
WP_005436299      7 FDIDRDVRIGLPEAVFCEGKSHDALLSLLKRFASDDEk-PILFTRLSeSVWARVPKDLRaA---YDYDPLSRTAWHRTC- 81  Sutterella w...
WP_005429858      8 FDLDRERRIGLPEAVFCAGKPFDTLAGLFARFALRNAp-PVLFTRLDaEVFAKIDPDTAgK---YNFDPLSRTAWNAVR- 82  Sutterella w...
WP_004032832    115 -EVPKT--LG-KVGIITAGTSDINIAEEARVIVEEGGCEAITSYDIGVAGIHRLFPQIAHMikEGVEVLIVCAGMEGALP 190 Methanobrevi...
WP_005661208    113 -ENEIGlySG--VTVVAAGSSDVPVAEEAAVTAEYLGCDVRRVFDVGVAGIHRLLSYADVL--MSSKVIVAVAGMEGALP 187 Dethiosulfov...
WP_008521251    113 -KARYG-----GVTVISAGSSDVPVAEEAAMTAEYLECQVTRLYDVGVAGIHRLLSHASVL--AESRAIVVVAGMEGALP 184 Jonquetella
WP_006768366     88 -APEPT---GvSVLVLCAGTSDLPVAREALHTASYLGRSVSLIADVGVAGIHRLLSYEAEL--QAAGVIVIAAGMDGALP 161 Corynebacter...
6_ncbifamImport  74 rLSAPFssEG-EVLVVTGGAADLPVAFEALGTLRFNGIDAGLVSDVGVAGLHRLTPHMDAL--TAAKALIVVAGMEGTLP 150
WP_007945019     80 -LPQRP---G-KVAVVTAGTSDLRVALEATRTLGFMGVDYTLVSDVGVAGIWRLLERVEDI--KHHDVIIVAAGMDAALP 152 Pseudomonas ...
WP_007618724     80 -QKLST--KN-DVCIVSAGTSDQAVAMEAKRTLAFNGYQAPIFADLGVAGLWRLMEKIDEL--RQYKIIIALAGMEGALF 153 Paraglacieco...
WP_005028965    112 --PPKG--KG-RVAVISAGTADGFVAWEAARTLAYLGIGHKLFEDCGVAGLWRLAERLEEI--NTFDAVIVVAGLDAALV 184 Bilophila wa...
WP_005436299     82 -PRHET---G-LASIVSAGTADAFVTHEVARTLEYLGWTVRLFEDCGVAGLWRIQAARDDI--NKGDVVVVCAGLDAALA 154 Sutterella w...
WP_005429858     83 -PRRPG-----VCAVVSAGSADAPVVMEAARTLEYLGYEVKPFIDCGVAGLWRIEAALPEI--NACDAVICAAGLDAALA 154 Sutterella w...
WP_004032832    191 SVVAGLVDIPVIGVPTSVGYGVGEGGVVALNAMLQSCAPGIAVVNIDNGFGAGVFALTI---IKG 252 Methanobrevibacter
WP_005661208    188 GVVAGLVGCPVIAVPTSIGYGANFGGLSALLTMINTCATGVSVVNIDNGLGAGYTAGII---ARQ 249 Dethiosulfovibrio peptidovo...
WP_008521251    185 SVVAGLSGCPVWGVPTSVGYGANLGGLTALLSMVNSCATGLSVVNIDNGLGAGVCAALS---VRQ 246 Jonquetella
WP_006768366    162 SVVGGLVSCPVVAVPTSVGYGAGAGGIAPLLTMLNTCAPGVGVVNIDNGYGAGHLAAQI---AAR 223 Corynebacterium efficiens
6_ncbifamImport 151 GIVAGLVKAPVVAVPTSVGYGTGLGGLSAILTMLNACAPGLAVVNIDNGYGAAAFAVKMtrsHRR 215
WP_007945019    153 TVMAGLVGKCVIGVPTSVGYGVAAGGQTALNAMLASCGQGVLVTNIDNGFGAACAAVRI---LNA 214 Pseudomonas sp. GM21
WP_007618724    154 SVLAGLVRAPIIAVPISVGYGVSAGGNTALGSALASCSPGILTVNIDNGFGAANAAIKI---LNQ 215 Paraglaciecola arctica
WP_005028965    185 SVMGGLTPKPIFGVPTSVGYGAAQGGRAALASMLSSCAPGVGIMNIDNGYGAACAAARVv--NGL 247 Bilophila wadsworthia
WP_005436299    155 SVMGGLTSKPVFAVPTSVGYGIAEGGRAALSSCLASCAPGVAVMNIDNGYGAACAAARV---LTL 216 Sutterella wadsworthensis
WP_005429858    155 SVLGGLTMRPLFAVPTSIGYGIAQGGETALRSMLASCAPGVAVLNIDNGYGAACAAARV---LAA 216 Sutterella wadsworthensis
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap