Conserved Protein Domain Family
YlcG_phage_expr

?
NF033498: YlcG_phage_expr 
YlcG family protein
Members of this family include YlcG from the DLP12 prophage region of Eschichia coli K-12, and homologs from the Gifsy-1 and Gifsy-2 prophage regions of Salmonella enterica subsp. enterica serovar Typhimurium str. LT2. Members of this protein family are small, about 46 amino acids long. YlcG is known to be expressed. It is encoded immediately downstream of the Holliday junction resolvase RusA.
Statistics
?
PSSM-Id: 411140
Aligned: 44 rows
Threshold Bit Score: 54.5615
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_087878304  1 MKPETLEILRARWQRLRIYRYRGSVLVDYRILRNFVHTYHS 41  Enterobacter
WP_023235158  1 MKPELIEILRMRWQRLRIYRRPGSVLVDYRILRNYVRIEAK 41  Salmonella enterica
AKR76986      1 MKPEMIEILRMRWLRLRIYRHPGSVLVDYRILKNVIRNYQL 41  Edwardsiella sp. LADL05-105
WP_046093601  1 MKPELIEILRMRWQRLRIYRRPGSVLVDYRIIRNSVRLLKK 41  Salmonella enterica
WP_079844538  3 FESYFADHLRVRWQRLRIYRRPGSVLVDYRIIRNTVRLLKK 43  Salmonella enterica
CEJ64107      3 PE--LTEILRVRWQRLRLYHFPGSVLTDYRILKNYIKIIGG 41  Citrobacter pasteurii
KWZ91850      3 FEPFFADHLRVRWQRLRLYHFPGSVLTDYRILKNYIKTIGG 43  Citrobacter freundii
WP_097432389  3 FESYFADHLRVRWQRLRLYHFPGSVLTDYRILKNYVKTYAG 43  Escherichia coli
WP_089644379  3 FEFNMAELLRHRWGRLRLYRFPGSVLTDYRILKNYAKTLTG 43  Escherichia coli
WP_097762706  3 FEFYMAELLRHRWMRLRLYRFPSSVLTDYRILRNYAKTLKG 43  Enterobacteriaceae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap