Conserved Protein Domain Family
small_SPW0924

?
NF033490: small_SPW0924 
SPW_0924 family protein
Members of this family average less than 44 amino acids in length, and are found exclusively in the Actinobacteria (mostly Streptomyces). The N-terminal half is organized like a signal peptide, beginning Met-Arg and then continuing with a hydrophobic stretch that is unusually rich in alanine. The C-terminal region has a nearly invariant motif TSPxPLLTTVP. The function is unknown.
Statistics
?
PSSM-Id: 411132
Aligned: 27 rows
Threshold Bit Score: 28.9271
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_017238693  1 MRALVAAAIGLAPVLLFVLLVSLVELPPdGPTSPKPLLTADPGPK 45  Streptomyces
WP_018512101  1 MRALVAAAIGLAAALALVFTLSAVGSPP-GETSPKPLLTTVPGPK 44  Streptomyces
WP_018957585  1 MRALVAAAIGLAAALVLVFTLSAVGSPA-GETSPKPLLTTVPGPK 44  Streptomyces sp. CNB091
WP_018488070  1 MRALVAAAIGLAAALALVFTVSAVGSPP-GETSPEPLLTTVPGPQ 44  unclassified Streptomyces
WP_019885399  1 MRALVAAAIGLALACALVAGAAAMGAPP-GETSPKPLLTTVPGPK 44  Streptomyces purpureus
WP_003956636  1 MRPLAAAALGLAAAVALVLTATAIGPPQ-DGTSPEPLLTTVPGPK 44  Streptomyces clavuligerus
WP_014180553  1 MRALAAAAIGLAAALALVFTVTAIGVPS-GKTSPKPLLTTVPEHP 44  Streptomyces
WP_016576502  1 MRALIAAAVGLAAALALMFTVTAIGAPE-GRTSPKPLLTTVPAHP 44  Streptomyces albulus
WP_016639761  1 MRALIAAATGLAVALALVLTITAIGAPP-GETSPEPLLTTVPKHP 44  Streptomyces
WP_016468242  1 MRALVAAGIGLVAALALVFAITAMGVPP-GETSKKPLHTTVPEHP 44  Streptomyces
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap