Conserved Protein Domain Family
harvest_ssl1498

?
NF033486: harvest_ssl1498 
ssl1498 family light-harvesting-like protein
Members of this family appear restricted to the Cyanobacteria, and include ssl1498 from Synechocystis sp. PCC 6803. These proteins are small, usually about 56 amino acids, with an N-terminal half related to a number of light-harvesting proteins, and a highly hydrophobic C-terminal half likely to be embedded in membrane.
Statistics
?
PSSM-Id: 411129
Aligned: 122 rows
Threshold Bit Score: 53.3051
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_011358893  4 TTEDGGLLNAFAKEPRMEVMDQNASRDRnRSSLMMLIGGSILVTGLIAITVVIS 57  Synechococcus sp. CC9902
WP_009343700  4 TEEEGGLLNNFAQEPKVYEAEPPTAKQK-LNYIILGGLGALLIVGVIFIAFAVS 56  Aphanizomenonaceae
WP_018398295  4 TNEEGGRLNNFAAEPKVYKAEPPSPTEK-RNYIIMGIGALVLVSSLMFIAVTVS 56  filamentous cyanobacterium ESFC-1
WP_017305832  4 TQEEGGRLNNFAAEPKMYVAEPPSKKEQ-RNYIIAGAAALALVSGVIFIAFSIS 56  Spirulina subsalsa
WP_011611818  4 TTEEGGRLNNFAQEPKVYQAEAPDQNQQ-KLYLILGALGTFLIVSLVFVAFSVS 56  Trichodesmium erythraeum
WP_015118450  4 TTEEGGRLNNFAREPKVYKAEPPNKKQQ-ITYIVLGVAAAALLGGVFFVAFSVS 56  Rivularia sp. PCC 7116
WP_017746483  4 TTEEGGRLNNFAREPKVYQAEPPNQKQQ-LNYVVLGAIGLVLVGGLIFVAFSVS 56  Scytonema hofmannii
WP_006198032  4 TNEEGGRLNNFASEPKVYQAEPPTNKQK-ITYILLGLAGAGLVVGLIFVAFSVS 56  Nodularia spumigena
WP_012410406  4 TNEEGGLLNNFAREPKVYQAEPPTEGQK-RTYLILGIAATALVVGLILVAFFVS 56  Nostoc
WP_015083315  4 TNEEGGLLNNFAKEPKLYQAEPPTNSQK-RTYIILGIAAVLLIGGVIFVAFTVS 56  Nostocales
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap