Conserved Protein Domain Family
bifunc_MprF

?
NF033480: bifunc_MprF 
bifunctional lysylphosphatidylglycerol flippase/synthetase MprF
The C-terminal region of MprF tranfers lysine from a charged tRNA onto phosphatidylglycerol to make lysylphosphatidylglycerol (EC 2.3.2.3). The N-terminal region of MprF acts as a flippase. MprF helps confer resistance to antimicrobial cationic peptides.
Statistics
?
PSSM-Id: 411123
Aligned: 181 rows
Threshold Bit Score: 558.665
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_019914852  23 LRAVRALFPLVIIVLVYLEGQHELKKVHLRLIIRELKHVPASAIAQMMGAALLAVAVMSAYDYLIRQHFRLKISHWSTFR 102 Paenibacillus s...
WP_010246186   8 LKNIKPIFLSGVILLIVLEFGKLRKEISLEEISRIFYEINLIKIFAMAILGFVSFLPMLGYDFLLKKFLKInRDKKYIVK 87  Peptoniphilus r...
WP_004911429   5 KNLLLRLVIPTITLILVTQLIIMTREITWQAIWSSINDVAWWQAALLILLGFLAVIPTLYNDQILSRWQGYQltnGELLQ 84  Leuconostoc
WP_014324285   5 NHVLSKLIILVITLVLITQLFIMTREITWHAILSTMNDIAWWQMVLLLLAGFLVIMPTLFNDLILREWQGYGlttSEMLQ 84  Leuconostoc mes...
WP_010373206   5 WHNIRRVMIIAVAFVALFELGAVIKRMPLKILLAIFAEIPIGLLIGIFVIGILTASVGVSYNWAYKRLLTPTd-sKHYWL 83  Weissella
WP_010001211   5 KQLLSRLIVPAVTLILIGQTIYMTREITWDMIFSTINDIYWWQAILLMILGFIAVLPTVLNDMILAKWQHYQiemPELLQ 84  Leuconostoc lactis
WP_004900094   5 KSILSHLIIPAVTVILISQLVFMTREITWNMILETISQITWWQALLLIIFGFVTIVPTLLSDFILARWQAYNikrTDLIQ 84  Leuconostoc cit...
WP_004818464   9 KEIFKKIFLVSVLILVIIQFRKISKEIKVEDIKYIFKNLSIFIIILMGIYGIFANIPASLYDFVLNDELDNdYEKKYIAE 88  Anaerococcus hy...
WP_013231827   5 KHILSRLIVPTTTIILVIQLIFMTREITWRMIISTINDVAWWQAVLLIVFGFLAVLVTTFNDTILAKWQNYRigkVELYQ 84  Leuconostoc
WP_002836326  15 LKYIRTTYTIIFTIIVLYIVRN--NFIAPNHIFKYKIFLSIAQKLQIALFGLLVFLISSISYFLYNKNFDFK-----DIK 87  Finegoldia magna
WP_019914852 103 YSWIANTFNNLIGFAGLAGVGLRTLLYKKSGVPAAVLTPaIVFLSPLMITGLSLLSWGNIFGLFPAAALLREHHWLVFAV 182 Paenibacillus s...
WP_010246186  88 RSITINSFNNLIGFGGVINLGLRMRYFGEEKEDKHLFEF-LVKSLLFDLAGISFLAIISLIFLLISK--SKILINYKIWL 164 Peptoniphilus r...
WP_004911429  85 RSWLVNVINLNVGFFGVFSVLLRRIFYSDQTRKN-GVKP-FVQMYFLGQTGLLLLAVLVLFDLLVWHSHY--FADEIGWL 160 Leuconostoc
WP_014324285  85 RAWLVNVFNLNAGFIGILSVFLRRIFYNDQPKQK-PIKP-YIQMYILGQSGLLFATVVAFVILILDANKQ--LTEQLVWL 160 Leuconostoc mes...
WP_010373206  84 SSWVVNAFDNAFGVADFVVTWLQDRLFDDNRTER-SAT--LHRGWWLSTSGLAVVSLLSLIATGIYWSHTA-VVNYAPWL 159 Weissella
WP_010001211  85 RSWLINVFNINAGFVGTVGVLLRRIWFADQKNGG-RLKP-YIQMYVLSLGGLFIASVMALVAIWLNIIPD--FDDNLIWL 160 Leuconostoc lactis
WP_004900094  85 RAWLINVFNINAGFIGTVSLLLRRVFYFDQKKSS-HLKP-YLQVYLLGLTGLLVASAAAIVAIWLHFLTG--FEENMIWL 160 Leuconostoc cit...
WP_004818464  89 TGFCINNFNDLLGLGGFISIGLRTAFYGKGHEPSKLVKK-IIELLVFLPCGLSFFSILSLISLYFHE--NPVLERYMILL 165 Anaerococcus hy...
WP_013231827  85 RAWLINVFNINAGFAGTVSVLLRRILFFDQSKPN-QLKP-YFQMYVLSLTGLLLTSVCAFLALFLKIIPT--FDDIMVWL 160 Leuconostoc
WP_002836326  88 KFWVLESLRKFVWIKGLESVFIGEDEYRNQNLNKNISN----FIALSLISIFTIFLMKPEWTLFLIYLVILVIGICVIYF 163 Finegoldia magna
WP_019914852 183 WGMALYLPLFIIIQRSSLFAKWi-NRGQgrtpwttvAASVGASLLEWLFAGITFCIIASHLLGCAN-YITVFSIYVIAAI 260 Paenibacillus s...
WP_010246186 165 IGGVLYYPVLFLAS-KIRNDGEfaISKky------aAEVSLVSFLEWLGACLFFIFIGFVLGIKVK-FFNILSIFVIANI 236 Peptoniphilus r...
WP_004911429 161 AVLIIVGMAALAVS-LSSRLKAwdGLTWpv-----aGQLMLNAVVAVSAQMILFLIIGIIINVQ-LsWLNILIVFVIAST 233 Leuconostoc
WP_014324285 161 ALFILVAIIGIIVS-FSKRINIwqSLNStv-----vARFIINSVITLFAQVGLFILIGRIIDID-IgPSEIILSFIISSA 233 Leuconostoc mes...
WP_010373206 160 VVAVALPFIGLIVSRFRHRDSLpfSASDy-------ARIFAASLATWVANTAGFLLIGALFQMP-IaIWSVMPLFIAART 231 Weissella
WP_010001211 161 MVLLAVAVVVGIIS-LIPRFNFwsGMTQra-----fVLLTSNAVLTFAIQMALFVTIGLTIGVD-VrIAMMMLLFTIANT 233 Leuconostoc lactis
WP_004900094 161 IAILMMAIVVGFIS-IVPRFHFwqGINLlv-----vKRLLTVSLASFVLQMALFVAIGVTLGIH-LrLAIMMLAFILAST 233 Leuconostoc cit...
WP_004818464 166 IGASLYIPIVFGLS-FFG---KikFKKkn------qIKLFIISIAEWFGVMSAFVVIGYLMGIKFD-LITLSTLVVAANI 234 Anaerococcus hy...
WP_013231827 161 ATILIITSIIVTIS-LIPKLHLwlGMKRai-----aKKFIGISCLALLLQMGLFVITGITIGVSSIqVSMMMFLFVIAST 234 Leuconostoc
WP_002836326 164 KNKSPYYLDFVVKDNISVKRk--------------vLSVAYETVVTICNILFFVFAIKQFTNVNLS---SLVLIYCVSNV 226 Finegoldia magna
WP_019914852 261 AGILSMAPGGIGAFDLIALLGLSQLGYGSDKAMAVLVIYRLFYYLIPWLIGLVMAALEIGLQSKKssdrsnvgiepslnl 340 Paenibacillus s...
WP_010246186 237 IGIASFMPGSIGSFDLVALAALTSVGVKSEVVFSWILLYRIFYYIIPFAIGFLFFMEDLGSVFDE--------------- 301 Peptoniphilus r...
WP_004911429 234 IALISMAPGTWGAFEVAVLLLISLLGISRVDGVIWLILYRVTFNLVPLLSALGLLFFRLSKQINN--------------- 298 Leuconostoc
WP_014324285 234 IALITMTPGTWGSFDVAIIIMLSFFDVARVDSFIWLILYRVSYNLFPLLSAVALLFLRISKRINA--------------- 298 Leuconostoc mes...
WP_010373206 232 FGIVTLVPGGWGTFDIFAFIGLQTLGMDPAVIFLWILFYRVAYTIVPFIIAVIIAATRALRETNH--------------- 296 Weissella
WP_010001211 234 IALVTMTPGTWGSLDVSLLLMLSGLSVDIEKVVVWLILYRLVYNMLPLFSAIVLFCYRLSRKINR--------------- 298 Leuconostoc lactis
WP_004900094 234 IALVSMTPGTWGSFDVAVLFILSDLSVNSDQVVVWLILYRVVYNVIPLLSAFILLIYRLSKKINS--------------- 298 Leuconostoc cit...
WP_004818464 235 VGYISMIPGAIGSFDLIILLALKSQGIDQELALSWILLYRLAYYIIPFCLAFVFFSKNFTKAFQF--------------- 299 Anaerococcus hy...
WP_013231827 235 IAFVSMTPGSWGSFDVAMLLLLSNVDVSQDRAVVWLILYRVFYNILPLFSALGLFFYRLSRKLNV--------------- 299 Leuconostoc
WP_002836326 227 FGQVSLMQDGFVVSDLIEIHFLCKL-IEPRAAIIAILIYRIVSSVIPWIISLIMILKRIYDNYNT--------------- 290 Finegoldia magna
WP_019914852 341 wqkiWGWPGQYTFLSDLGIWALGKLVLASGLILLLSAATPELLYRLRLTEellSLp--VMRIShHVSVLIGFMLILLSRG 418 Paenibacillus s...
WP_010246186 302 ----KKDNIPSKIIKSLGLDLSSTMLYITGAFMIISTTIPDELGKFQWLKnfs--plhANLIYqFPSLFFGFSFIILGRS 375 Peptoniphilus r...
WP_004911429 299 ----NFRGVPHYVAQAVVHRLVTIALYLSGILLVLSGTMPQIVERIPLFNqlrLWpitYALANqLPSILLGFLILMNARG 374 Leuconostoc
WP_014324285 299 ----SFRGVPHYVAQSVVHQFLIIILYLSGMLLVLAGTMPKVAEQIFVFNhlrSWpvtYTLINqLPNILFGFLILISARG 374 Leuconostoc mes...
WP_010373206 297 ----KFRGVPSVIVRSMLQKAVTVLLYFSGITLIIAGALPGTLQSFHLLQhlsPWt--SGFLLqVPNIFIGFMLIIAGRG 370 Weissella
WP_010001211 299 ----EYRGVPHYVALSVTHRLTTIALYLSGILLVLSGTMPGIMQRVTILHhlrPWpitFALANqLPNLLLGFLLLISARG 374 Leuconostoc lactis
WP_004900094 299 ----DYRGVPHYVARAVTHQVTTVMLYLTGILLVLSGTMPTIVQRVMILNhlrSWpitYALANqLPNILLGFLLLISARG 374 Leuconostoc cit...
WP_004818464 300 ----KEAGFLKRLFKNITVLFNTFMMYIFGLFMILAATLPDKAYGGGLLTkln--pirASAIYqFPSILFGFIFIIMARA 373 Anaerococcus hy...
WP_013231827 300 ----DYRGVPHYVAGMVTHRIITVTLYLLGFLLVLSGTMPDVAQKVMGLNrlwILpsvYAIANqLPNIILGFLLLISARG 375 Leuconostoc
WP_002836326 291 ----------DQYKKQFAFNILSIFTLIVGLILCLSVATPSMLLRIKFLKrfvKKd--VVILArFITLTSGGLLILLSQG 358 Finegoldia magna
WP_019914852 419 ISLRVHRAYILTCALLFGGAVFTFTKGFDYEEALFLLLVVLILWVSRARFNRISVPFSKQSTIWWLVLTSAIAFIYfllg 498 Paenibacillus s...
WP_010246186 376 TREKVKRTTKVTLIYLVLALTYSILSGFGFIEMFFIIILIFLTITTRKIPHREQLVYSSEAVTTDMVILGIISIVTiyfm 455 Peptoniphilus r...
WP_004911429 375 VANRVARAYQSTIIVLSLTVVYVLFFYRHLLPLILIGLVLMAVIFSKKTLYRSQFIHAWEEQTVDGVIWGALIAGYlmlg 454 Leuconostoc
WP_014324285 375 IANRVQRAYGATIVVLLLVATYVFLFYQYVAPLFFIAVILIAVLFSKKSLYRKQFIHSWEEQAVDFLIWATLIISYlalg 454 Leuconostoc mes...
WP_010373206 371 IANKVSRAYWPTLILLAISFGYVAVSHEHMQPLVLLGALFIGTLFIKPTLTRVQFIYSWENRLVDGVIYGGLFIAYltig 450 Weissella
WP_010001211 375 VANRVKRAYYSTIVLLVLVVIYAYMSYRQILPVIIFGLLLIGFMFSKKTLYRKQFIHSWQQQVIDGTIWGALIISYlllg 454 Leuconostoc lactis
WP_004900094 375 VANRVKRAYQSTIVLLVVIIIYALFEYRHIVPMVLVGVLLFAFMTTRQTLYREQFIHSWEEQIVDGAIWGALIISYlllg 454 Leuconostoc cit...
WP_004818464 374 YISRQKKSYILNIVILSLVFLYTYITGYSLSTLIYIVIMFVMNLITKDELHTKQFIYASEDRFIDLLLANFMLIVYvgki 453 Anaerococcus hy...
WP_013231827 376 VANQVIRAYKSTILVLVLVVIYTLISYQYIAPVIFVAVLLIAFILSKKTLYRQQFIHSWEQQVVDGVIWGTLIISYlllg 455 Leuconostoc
WP_002836326 359 IKKSVKKSFYIAEAVLIVSVFSTLLKGLDIEESIITLLLGIVMYIMKDGFTEQAIKIKPKYFINTIGKLSVVTVLFifis 438 Finegoldia magna
WP_019914852 499 syvHQGFPR-HLPAGIPPEWLRRHSNVAVTAVSGLVLSWLLMTMLVVLRPHRRMEELLADKDMTQLSQFLGGNEGNALTH 577 Paenibacillus s...
WP_010246186 456 a----inyklKPINPKDFFIVPFENSFLHFVIVFTLLIVSASFLSRYLKGK--RIKLGEKMDPEKILSLLEIYDSHPESG 529 Peptoniphilus r...
WP_004911429 455 fmhVPSIHRhFI----HVGHLPSIHWWWLGAVTIAIVAISVWLLAQFLHAKQ--RPLGTEFDEMRVQEVLSLGDN-HYTS 527 Leuconostoc
WP_014324285 455 vvnLPPIHRhFR----HVGNMPSMHWWYVGLIIISVVSVSSLALSKFLHSQQ--IPLGVGLDEARVNKVLTIGDN-HYTN 527 Leuconostoc mes...
WP_010373206 451 vanLPAVSHrFHVRTSGFFLVPSLHWWLIGFIAIAIVSLGVLGFIAYMQGRT--QLLGEALDEERVNQVLARGDN-HYTN 527 Weissella
WP_010001211 455 midAPIVKNhFQR-LTHLGLLPSVHWWLMGTAIILVVTVFSLLLSRYLRAHK--QQLGVPFDEARLQRLLAIGDT-HYTN 530 Leuconostoc lactis
WP_004900094 455 ivnTPIFKHnYH--FHERGMIPSVHWWVMGAIVILVVATFSLLLSRYLHAHQ--QQLGESFDEIRLNRILTIGDT-HYTN 529 Leuconostoc cit...
WP_004818464 454 lkhGSIid-vNISDANDFILIPFEYNFASIIVTISIIYFLSYLLIRFLQGS--RLKIGEKFDRDRYLSLLESQGGSKEAF 530 Anaerococcus hy...
WP_013231827 456 vihAPFVQHrFHN-LNHTGIMPSLHWWIMGVAVILMVSVFSVLLLRYLHAHQ--QQLGFIFDEERLNNMLAVGDT-HYTN 531 Leuconostoc
WP_002836326 439 ntvRKVNFLtSHRKYSLNYLVEN----KKFILLYVLFVLILSYLAQYTRTKKITFTKLTDEDFDKIDKFLEEFGGNEFSH 514 Finegoldia magna
WP_019914852 578 MLFLGDKSFYWAQG-----GKVLIAFARARDKLVVLGDPLGPQALVGEAISEFRQAADLYGLSVVFYQATPDFLPVYHEQ 652 Paenibacillus s...
WP_010246186 530 LALVGDKEIYYYKDee--vATCGMSIYTYKDKIIVMGEPFGNKEDFDKLLDKFIRDADTYGYSPIFYEIGEKQTIKLHDY 607 Peptoniphilus r...
WP_004911429 528 LIFLGDKRLYFYQIke--hDVVGLQFRLVNNKAMVMGDPFGESHYFAEAMQAFVEEADRLGYVPVFYEVSERVAMLAHEF 605 Leuconostoc
WP_014324285 528 LVFLGDKRLYFYRIdd--eDVVGIQFRIINNKAMVMGDPFGNEKYFAAAMEQFVNEADVLGYMPVFYEISENIAMMAHEF 605 Leuconostoc mes...
WP_010373206 528 LIFLGDKRLFYYRPdqsetDTVAIQFRLVNNKAAVMSDPFGDSADFQAALAAFISEADRLGYTPIFYEVSEKIAMMVHEF 607 Weissella
WP_010001211 531 LAFLGDKRFYFYQVdg--qDRVGLQFRVINNQAMVMGDPFGDATYFADAMQQFVDEADVLSYVPVFYEVSERIAMLAHEF 608 Leuconostoc lactis
WP_004900094 530 LAFLGDKRFYYYQVnh--eDSVGMQFRLVNNKAMVMGDPFGDASYFAEAMQQFVDDADVLGYVPVFYEVSEQIAMLAHEF 607 Leuconostoc cit...
WP_004818464 531 LAFLDDKDLFWLRKdg--lDLACLQIKTIADKVVVMGDPIGNEEHFDELLDEFINQADDLGYNIVFYEINKEITMKVHEY 608 Anaerococcus hy...
WP_013231827 532 LAFLGDKRLYYYQVnn--qDVLAVQFRIINNKAMVMGDPFGDANYYAEGMQQFVEDADILGYMPVFYEVSERIAMLAHEF 609 Leuconostoc
WP_002836326 515 LVYLNDKNVYFDKT-----NTVMIMYRPVKNSVIVLGDPIGKKENFVEAIDDFIVYCNEYHMNVCFYEINGENLELYCDQ 589 Finegoldia magna
WP_019914852 653 GYRFFKLGEEAMISLADFTLSGKKNSDLRSVKNRFEREGYRFEVAEAPHSPELLEELRRVSGEWLDGRSEKGFSLGWFKP 732 Paenibacillus s...
WP_010246186 608 GFSFLKFGETANIELEKFSLEGKKHKMQRKVLSKFERNNYTFEVLKPPYDEEFLNKLENISANWLGDKKERGFSLGYFDR 687 Peptoniphilus r...
WP_004911429 606 GYDFFKLGEEAHVNLADFSTAGKKMQNIRSEINQAGRAGFEFKVLTPPFSPAVLTQMQAISDEWLAGRDEKGYSLGFFDP 685 Leuconostoc
WP_014324285 606 GYDFFKLGEEALVILDDFSTAGKKMQNIRSEMNQATRAGFKFKVLEPPFKHDVLQQMQLISDEWLAGREEKGYSLGFFDE 685 Leuconostoc mes...
WP_010373206 608 GYNFMKLGEEAWVDTPSFKTAGKKFANIRSEINQATAAGFTYEVLQPPFSDALLQELRQISDEWLHGREEKGYSLGFFDN 687 Weissella
WP_010001211 609 GYDFFKLGEEAHVIVTEFSTAGKKMQNVRSVINQANRAGFEFKVLQPPFSAEVMAQLQAISDEWLAGREEKGYSLGFFDE 688 Leuconostoc lactis
WP_004900094 608 GYDFFKLGEEAHVVLDAFSTAGKKMQKVRSVVNQAGRAGFEFKVITPPFNEEILKQLQKISDEWLAGREEKGYSLGFFDQ 687 Leuconostoc cit...
WP_004818464 609 GFNFMKFGESANVNLEEFNLDGKKKKNLRKTINKIDRDGYKFEVMEKPFDGKTIKRLQEISNSWLGEGKEKGFSLGFFDR 688 Anaerococcus hy...
WP_013231827 610 GYDFFKLGEEAHVVLDQFSTSGKKMQNIRSVMHQATRGGFEFNVLQPPFSQDIMMQLRTISDEWLAGREEKGYSLGFYDD 689 Leuconostoc
WP_002836326 590 GFRFVKVGQDATVDLTQFSLVGKKNRTWRHVLNNFDKGN--YEFKVEDPTDNLLSQMKIVSDKWLENKNEMGFSLGFFDE 667 Finegoldia magna
WP_019914852 733 SYLQLAQLALLRDADGKVLAFASIAPGYDkgTTISVDLMR-HRKKTPNGTMDYLFVRLLEWAKEQGYRRFNLGNAPLSSV 811 Paenibacillus s...
WP_010246186 688 DYLKFCDMAVVRDEDKNILAFANIMPNPNs-VCATIDLMRyKKDENLDSIMEYLLLKLTIYFKEQGKKYFEIGMAPLSNV 766 Peptoniphilus r...
WP_004911429 686 NYLQRGEVAILEK-DDRIEAFASLVV-SHteKQMAVDLMRfTAS-APNGVMDVLFVNVFKYAKAQNYETFNLGMSPLANV 762 Leuconostoc
WP_014324285 686 NYLQRGPIAVLEK-EGQIEAFATLVT-SYteQQMTVDLMRfTHA-APNGVMDVLFVNVFDYAKQRHFKIFNLGMSPLANV 762 Leuconostoc mes...
WP_010373206 688 HYLQRGGIGVLKAPDGHIVAFATLVT-SEteNQMTVDLMRfTSE-SPNGTMDVLFVKTFEYARDAGYNTFNLGMSPLSNV 765 Weissella
WP_010001211 689 NYLQRYPIAVLEK-DGQIEAFATLVT-SHteQQMAVDLMRfTKK-APNGVMDVLFVNTIAYAKEKGLATLNLGMSPLANV 765 Leuconostoc lactis
WP_004900094 688 NYIQRYPIAVLSK-DNRIEAYATLVT-SHteRQMAVDLMRfTKA-APNGVMDVLFVNTIAYAKSQGLQILNLGMSPLANV 764 Leuconostoc cit...
WP_004818464 689 NYLNTGDIAVVKNPDGKIIAFANLCPIYYk-NWATVDLMRy--DDKVDGLMDYLFINIFTYLKENNIKYFDLGMAPLANV 765 Anaerococcus hy...
WP_013231827 690 QYIQRYPIAVLEK-NSHIEAYATLVT-SHteQQMAVDLMRfTKK-SPNGVMDVLFVNTIAYAKAQGLMTLNLGMSPLANV 766 Leuconostoc
WP_002836326 668 DYLKRTKIACIYK-EGELLAFANLQP-FYddKTLSIDLMRy-DKSNEDGLMDFIFIKLILWGQENNFEKFYLGMAPLSKV 744 Finegoldia magna
WP_019914852 812 GQNSGALREEKLAHLVFVRGGHWYGFAGLRMYKEKFSPEWEPRYLAYPASMTLSILTLDLVRLVSR 877 Paenibacillus sp. HW567
WP_010246186 767 GINTNSFVEEKVAYLIYKFGYKFYSFEGLRAYKEKFSPTWDPVYLSYPNKTWILNNMIAIFIVDIV 832 Peptoniphilus rhinitidis
WP_004911429 763 GLHRQSFGRERLANLVYQFGSKVYSFEGLHHYKNKFSPTWQAMYIAYSRKSSIIAVMIGLLKVDNK 828 Leuconostoc
WP_014324285 763 GQHRQSFGRERLANLVYQFGSKVYSFEGLHHYKNKFTKVWQPMYIGYSRKSSIIAVMFGLLKIDNK 828 Leuconostoc mesenteroides
WP_010373206 766 GLHEQSFIRERVANLIYQFGSKIYSFEGLRHYKHKFASDWQPYYIGYSNHSNIAFVMIALLLIDNP 831 Weissella
WP_010001211 766 GQHRQSFGRERLANLVYQFGSKVYSFEGLHHYKRKFTKNWVPMYIAYSRKSWIIMVMIGLLKIDNK 831 Leuconostoc lactis
WP_004900094 765 GQHRQSFGRERLANLVYQFGSKVYSFEGLHHYKSKFTKTWVPMYIAYSRKSWIIMVMIGLLKIDNK 830 Leuconostoc citreum
WP_004818464 766 GVMRHSFLQEKMVYMIFKLGDHFYSFEGLKAYKDKYASFWEERYLSYSRGSSLIFSALTLFYVINK 831 Anaerococcus hydrogenalis
WP_013231827 767 GQHRQSFGRERLANLVYQFGSKVYSFEGLHHYKSKFTKKWVPMYIAYSRKSWILMVMIGLLKIDNK 832 Leuconostoc
WP_002836326 745 GDKIYSKKKEKILNIVYNTQNKIYNFKGLRNYKDKFKPNWSNKYIAYTSDFNLPYILINVVNSKKK 810 Finegoldia magna
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap