Conserved Protein Domain Family
internalin_K

?
NF033186: internalin_K 
class 1 internalin InlK
Internalins, as found in the intracellular human pathogen Listeria monocytogenes, are paralogous surface-anchored proteins with an N-terminal signal peptide, leucine-rich repeats, and a C-terminal LPXTG processing and cell surface anchoring site. Members of this family are internalin K (InlK), a virulence factor. See articles PMID:17764999. for a general discussion of internalins, and PMID:21829365, PMID:22082958, and PMID:23958637 for more information about internalin K.
Statistics
?
PSSM-Id: 411100
Aligned: 5 rows
Threshold Bit Score: 1084.34
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003734521   1 MSVKSNIVKIGVCFAVLAVPVSQTTFPVFAAEQTGLKASQDNVNIPDSTFKAYLNGLLGQSSTANITEAQMNSLTYITLA 80  Listeria monocy...
WP_014931395   1 MSVKSNIVKIGVCFAVLAVPVSQTTLPVFAAEQSGLKASQDNVNIPDSTFKAYLNGLLGQASTANITEAQMDSLTYITLA 80  Listeria monocy...
WP_012581402   1 MSIKSKIVKIGVCCAIVTVPVTQTTLPVFAAEQTGATASQDNVNIPDSTFKAYLNGLLGQASTANITEAQMDSLTYITLA 80  Listeria monocy...
WP_003730391   1 MSIKSKIVKIGVCCAIVTVPVTQTTLPVFAAEQTRVTASQDNVNIPDSTFKAYLNGLLGQASTANITEAQMNSLTYITLA 80  Listeria monocy...
WP_003738826   1 MSVKSNIVKIGICFAVLAVPVSQTIFPVFAAEKTGLKASQDNVNIPDTNFKQYLNGLLGQASTANITEAQMESLTYITLA 80  Listeria monocy...
WP_003734521  81 NINVTDLTGIEYAHNIKDLTINNIHATNYNPISGLSNLERLRIMGKDVTSDKIPNLSGLTSLTLLDISHSAHDDSILTKI 160 Listeria monocy...
WP_014931395  81 NINVTDLTGIEYAHNIKDLTINNIHATNYNQISGLSNLERLRIMGADVTSDKIPNLSGLTNLTLLDLSHSAHDDSILTKI 160 Listeria monocy...
WP_012581402  81 NINVTDLTGIEYAHNIKDLTINNIHATNYNPISGLSNLERLRIMGKDVTSDKIPNLSGLTSLTLLDLSHSAHDDSILTKI 160 Listeria monocy...
WP_003730391  81 NINVTDLTGIEYAHNIKDLTINNIHATNYNPISGLSNLERLRIMGTDVTSDKIPNLSGLTSLTLLDLSHSSHDDSILTKI 160 Listeria monocy...
WP_003738826  81 NINVTDLTGIEYAHNIKDLTINNIHATNYNQISGLSKLERLRIMGADVTSDKIPNLSGLINLTLLDFSHSAHDDSILTKI 160 Listeria monocy...
WP_003734521 161 NTLPKVNSIDLSYNGAITDIMPLKTLPELKSLNIQFDGVHDYRGIEDFPKLNQLYAFSQTIGGKKLINSDIKGSALTYNA 240 Listeria monocy...
WP_014931395 161 NTLPKVTSIDLSYNGAITDIMPLKTMPELKSLNIQFDGVHDYRGIEDFPKLNTLLAYSQTIGGKKLINSDIKSSKLTYNA 240 Listeria monocy...
WP_012581402 161 NTLPKVNSIDLSYNGAITDILPLKTLPELKSLNIQYDGVHDYRGIEDFPKLNQLYAYGQVIGGKKLINSDIKGSVLTYNA 240 Listeria monocy...
WP_003730391 161 NTLPKVTSIDLSYNGAITDIMPLKTLPELKSLNIQYDGVHDYRGIEDFPKLNQLYGYAQMIGAKKVINSNIKSSVLTYNA 240 Listeria monocy...
WP_003738826 161 NRLPKVSSIDLSYNGAITDIMPLKTTPELTSLNIQYDGVHDYRGIEDFPKLNQLYAFGQIIGGKKLINSDIKSSALTYNA 240 Listeria monocy...
WP_003734521 241 EKQTLYVPFSLMTERTVNYDGYVPDFVKSTAGSDTYFAMNEKQVNGNRLTITSDGLTVSDVSKADFDNLEKMEYNAKIDL 320 Listeria monocy...
WP_014931395 241 ENQTLYVPFSLMTERTVNYDGYVPDFVKSTASSDTYFTMNEQQVNGNRLTITSDGLTVSDVSKTDFDNLEKMEYNARIDL 320 Listeria monocy...
WP_012581402 241 ENQTLYVPFSLMTERTVNYDGYVPDFVKSTAGSDTYFSMNEKQVNGSRLTITSDGLTVSAVSKADFDNLEKMEFNARIDL 320 Listeria monocy...
WP_003730391 241 ENQTLYVPFTIMTERTVNFDGYVPDFVKSTASNDTFFTMNEKQVNGNRLTISSDGLTVSDVSKTDFDNLEKMEYNARIDL 320 Listeria monocy...
WP_003738826 241 ENQTLYVPFSLMTERTVNYDGYVPDFVKSTASNNTYFTMNEQQVNGNRLTITSDGLTVSDVSKTEFDHLEKMEYNARIDL 320 Listeria monocy...
WP_003734521 321 SSQTYNIPDQFKNGGAYNISVPIYDHYFTVDHSVNISADSGKTYIENQPVTEAEFLADIHAKTDDGSTVTSDFADKVDFK 400 Listeria monocy...
WP_014931395 321 SYQSYNTPEQFQNGGSYTISMPIYDHYFTVDHSLNITADSEKTYIENQLVTEATFLSDIHAKTDDGSTVTSDFADKVDFN 400 Listeria monocy...
WP_012581402 321 SYQSYNIPEQFQNGGSYTISMPIYDHYFTVDHSLNISADSGKTYIENQPVTEAEFLVDIHAKTDDGSTVTSDFADKVDFK 400 Listeria monocy...
WP_003730391 321 SYQSYNTPEQFQNGGSYTISMPIYDHYFTVDHSLNISADSEKTYIENQPVTEAEFLADIHAKTDDGSTVTSDFAEKVDFK 400 Listeria monocy...
WP_003738826 321 NTQSYNIPDQFKNGGSYTISAPTYDHYFTVDHSLNITADSEKTYIENQPVTEAEFLADVHAKTDDDSTVTSDFVDKVDFK 400 Listeria monocy...
WP_003734521 401 TPGTYTVTLQSENNSGLKAAPVQVNVTIKEKTAITADEKITYKVDTSKTEAEFLADIKAKTNDGTAITSDFATVVDLSKP 480 Listeria monocy...
WP_014931395 401 TPGTYTVTLQSENNAGLKATPIQVNVTIKAKTTITADEKITYKVDTSKTEAAFLADIKATTNDGTAITSDFATVVDLSKP 480 Listeria monocy...
WP_012581402 401 TPGTYTVTLQSENNSGLKAAPVQVNVTIKEKTAITADEKISYKVDTSKTEAEFLADIKAKTNDGTAITSDFATAVDLSKP 480 Listeria monocy...
WP_003730391 401 TPGTYTVTLQSENNSGLKAAPVQVNVTIKEKTAITADEKITYKVDTSKTEAEFLADIKAKTNDGTTITSDFATAVDLSKP 480 Listeria monocy...
WP_003738826 401 TPGTYTVTLQSENNAGLKAAPVQVNVIIKAKTAITADEKITYKLDASKTEAGFLADIKAKTNDGTAITSDFGAIVNLSKP 480 Listeria monocy...
WP_003734521 481 GKYVVTLNAENDLQKALPVQVTVIVEKETPIPDPTPNPTPdptpnptpTPDPTPDPSPTPNPVIKPNVNKPEVPSHKIPS 560 Listeria monocy...
WP_014931395 481 GKYVVTLNAENDLQKALPVQVMVIVEKETPIPDPTPTPTP--------DPTPTPDPSPTPNPVINPNLNKPEVPSYKIPS 552 Listeria monocy...
WP_012581402 481 GKYVVTLNAENDLQKAAPMQVTVTVEKETPIPDPTPDPTPdpt--ptpDPSPTPTPEPTPSPVINPNVNKPEVPSYKIPS 558 Listeria monocy...
WP_003730391 481 GKYVVTLNAENDLQKAAPMQVTVTVEKETPIPDPTPDPTPdpt--ptpDP--TPTPEPTPSPVINPNVNKPEVPSYKIPS 556 Listeria monocy...
WP_003738826 481 GKYVVTLNAENDLQKAVPVSVTVIVENETPIPDPTPSPTP----------------EPTPNPVINPNVSKPEVPSYKVPS 544 Listeria monocy...
WP_003734521 561 LTVNEKKAKAETSKEALPKTGDSLPVAGATVGFLLISLSWFVSRKK 606 Listeria monocytogenes
WP_014931395 553 LTVNEKKAKAEPSKEALPKTGDSLPVAGATVGFLLIGLSWFVSRKK 598 Listeria monocytogenes
WP_012581402 559 ITVKENNVKAETSKNALPKTGDSLPVGGISVGFLLIGLSFIVSRRK 604 Listeria monocytogenes
WP_003730391 557 ITVKENNVKAETSKNALPKTGDSLPVGGVSVGFLLIGLSFIVSRKK 602 Listeria monocytogenes
WP_003738826 545 IAVEENNVKVETSKNSLPRTGDSLPVGGISVGFLLIGLSFIVSRKK 590 Listeria monocytogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap