Conserved Protein Domain Family
efflux_OM_AdeK

?
NF033143: efflux_OM_AdeK 
multidrug efflux RND transporter AdeIJK outer membrane channel subunit AdeK
Statistics
?
PSSM-Id: 411095
Aligned: 72 rows
Threshold Bit Score: 877.943
Created: 19-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_005055714   2 QTVWSISSRGFAISALALSLAACQSMRGPEPVVSTGTPESYAsySNASGTSIAEQGYKDFFADQRLLQVIDLALANNRDL 81  Acinetobacter b...
WP_070075835   2 QTVWSISSRGIAISALALSLAACQSMRGPEPVVSSDVPESFAsyGNASGKSIAEQGYKDFFADQRLLQVIDLALANNRDL 81  Acinetobacter
WP_004803104   2 QTVWSISSRGIAISALALSLAACQSMRGPEPVVSSDVPESFAsyGNASGISIAEQGYKDFFADQRLLQVIDLALANNRDL 81  Acinetobacter s...
WP_023271572   2 QTVWSISSRGIAISALALSLAACQSMRGPEPVVSSDVPESFAsyGNASGTSIAEQGYKDFFADQRLLQVIDLALANNRDL 81  Acinetobacter g...
WP_005150275   2 QTVWSISSRGIAISALALSLAACQSMRGPEPVVSSDVPESFAsyGNASGKSIAEQGYKDFFADQRLLQVLDLALANNRDL 81  Acinetobacter
WP_016651043   2 QTVWSISSRGIAISALALSLAACQSMRGPEPVVSSDIPDSYAsyGNASGTSIAEQGYKDFFADQRLLQVIDLALANNRDL 81  Acinetobacter c...
WP_005269582   2 QTVWSISSRGIAISALALSLAACQSMRGPEPVVSSDIPDSYAsyGNASGTSIAEQGYKDFFADQRLLQVIDLALANNRDL 81  Acinetobacter c...
WP_005243849   2 QTVWSISSRGIAISALALSLAACQSMRGPEPVVSSDIPDSYAsyGNASGTSIAEQGYKDFFADQRLLQVIDLALANNRDL 81  Acinetobacter
WP_005227056   2 QTVWSISSRGIAISALALSLAACQSMRGPEPVVSSDIPESYAsyGNASGTSIAEQGYKDFFADQRLLQVIDMALANNRDL 81  Acinetobacter
WP_004775217   2 QTVWSISSRGIAISALALSLAACQSMRGPEPVVSSDVPESFAsyGNASGKSIAEQGYKDFFADQRLLQVIDMALANNRDL 81  Acinetobacter
WP_005055714  82 RTAALNIQKAQQQYRISENNQLPTIGASGSAIRQVTPTRDPNNPYSTYQVGLGLTSYELDFWGRVRSLKDAALDSYLATQ 161 Acinetobacter b...
WP_070075835  82 RTATLNIQKAQQQYQISENNQLPTIGASGSAVRQVTPTRDPNNPYSTYQVGLGLTAYELDFWGRVRSLKDAALDSYLATQ 161 Acinetobacter
WP_004803104  82 RTATLNIQKAQQQYQISENNQLPTIGASGSAVRQVTPTRDPNNPYSTYQVGLGLTAYELDFWGRVRSLKDAALDSYLATQ 161 Acinetobacter s...
WP_023271572  82 RTAALNIQKAQQQYQISENNQLPTIGASGSAVRQVTPTRDPNNPYSTYQIGLGLTSYELDFWGRVRSLKDAALDSYLATQ 161 Acinetobacter g...
WP_005150275  82 RTATLNIQKAQQQYQISENNQLPTIGASGSAVRQVTPTRDPNNPYSTYQVGLGLTAYELDFWGRVRSLKDAALDSYLATQ 161 Acinetobacter
WP_016651043  82 RTAALNIQKAQQQYQISENNQLPTIGASGSAVRQVSPSVNPNNPYSTYQVGLGLTSYELDFWGRVRSLKDAALDSYLATQ 161 Acinetobacter c...
WP_005269582  82 RTAALNIQKAQQQYQISENNQLPTIGASGSAVRQVSPSVNPNNPYSTYQVGLGLTAYELDFWGRVRSLKDAALDSYLATQ 161 Acinetobacter c...
WP_005243849  82 RTAALNIQKAQQQYQISENNQLPTIGASGSAVRQVSPNVNPNNPYSTYQVGLGLTAYELDFWGRVRSLKDAALDSYLATQ 161 Acinetobacter
WP_005227056  82 RTATLNIQKAQQQYQISENNQLPTIGASGSAVRQVTPSRDPGNPYSTYQVGLGLTSYELDFWGRVRSLKDAALDSYLATQ 161 Acinetobacter
WP_004775217  82 RTATLNIQKAQQQYQISENNQLPTIGASGSAVRQVTPTRDPNNPYSTYQVGLGLTSYELDFWGRVRSLKDAALDSYLATQ 161 Acinetobacter
WP_005055714 162 SSRDATQISLISQVTQAWLNYSFANAQLKLADQTLKAQQDSYNLNKKRFDVGIDSEIPLRQAQISVETARNDVANYKTQI 241 Acinetobacter b...
WP_070075835 162 SSRDATQISLISQVTQAWLNYSYANAQLKLADQTLKAQQDSFNLNKKRFDVGIDSEIPVRQAQISVETARNDVANYKTQV 241 Acinetobacter
WP_004803104 162 SSRDATQISLISQVTQAWLNYSYANAQLKLADQTLKAQQDSFNLNKKRFDVGIDSEIPVRQAQISVETARNDVANYKTQV 241 Acinetobacter s...
WP_023271572 162 SSRDATQISLISQVTQAWLNYSYANAQLKLADQTLKAQQDSFNLNKKRFDVGIDSEIPVRQAQISVETARNDVANYKTQV 241 Acinetobacter g...
WP_005150275 162 SSRDATQISLISQVTQAWLNYSYANAQLKLADQTLKAQQDSFNLNKKRFDVGIDSEIPVRQAQISVETARNDVANYKTQV 241 Acinetobacter
WP_016651043 162 SSRDATQISLISQVTQAWLNYSYANAQLKLADQTLKAQQDSFNLNKKRFDVGIDSEIPVRQAQISVETARNDVANYKTQV 241 Acinetobacter c...
WP_005269582 162 SSRDATQISLISQVTQAWLNYSYANAHLKLADQTLKAQQDSFNLNKKRFDVGIDSEIPVRQAQISVETARNDVANYKTQV 241 Acinetobacter c...
WP_005243849 162 SSRDATQISLISQVTQAWLNYSYANAHLKLADQTLKAQQDSFNLNKKRFDVGIDSEIPVRQAQISVETARNDVANYKTQV 241 Acinetobacter
WP_005227056 162 SSRDATQISLIGQVTQAWLNYSFASAQLKLADQTLKAQQDSFNLNKKRFDVGIDSEIPVRQAQISVETARNDVANYKTQI 241 Acinetobacter
WP_004775217 162 SSRDATQISLIGQVTQAWLTYSFASAQLKLADQTLKAQQDSFNLNKKRFDVGIDSEIPVRQAQISVETARNDVANYKTQI 241 Acinetobacter
WP_005055714 242 AQAQNLLNLLVGQQVPQNLLPQQQVPRITQQSVFTAGLPSDLLNNRPDVKVAEYQLSAAGANIGAAKAQLFPTISLTGTA 321 Acinetobacter b...
WP_070075835 242 AQAQNLLNLLVGQQVPQNLLPQQQVASITQQNVFSAGLPSDLLNNRPDVKASEYQLSAAGANIGAAKAQLFPTISLTGSA 321 Acinetobacter
WP_004803104 242 AQAQNLLNLLVGQPVPQNLLPQQQVARITQQSVFSAGLPSDLLNNRPDVKASEYQLSAAGANIGAAKAQLFPTISLTGSA 321 Acinetobacter s...
WP_023271572 242 AQAQNLLNLLVGQQVPQNLLPQQQVARITQQSVFSAGLPSDLLNNRPDVKASEYQLSAAGANIGAAKAQLFPTISLTGSA 321 Acinetobacter g...
WP_005150275 242 AQAQNLLNLLVGQPVPQNLLPQQQVASITQQNVFSAGLPSDLLNNRPDVKASEYQLSAAGANIGAAKAQLFPTISLTGSA 321 Acinetobacter
WP_016651043 242 AQAQNLLNLLVGQPVPQNLLPQQQVARITQQSVFSAGLPSDLLNNRPDVKASEYQLSAAGANIGAAKAQLFPTISLTGSA 321 Acinetobacter c...
WP_005269582 242 AQAQNLLNLLVGQPVPQNLLPQQQVARITQKGALSAGLPSDLLNNRPDVKASEYQLSAAGANIGAAKAQLFPTISLTGSA 321 Acinetobacter c...
WP_005243849 242 AQAQNLLNLLVGQQVPQNLLPQQQVARITQKGALSAGLPSDLLNNRPDVKASEYQLSAAGANIGAAKAQLFPTISLTGSA 321 Acinetobacter
WP_005227056 242 AQAQNLLNLLVGQQVPQNLLPQQQVARITRQGVLSAGLPSDLLNNRPDVKASEYQLSAAGANIGAAKAQLFPTISLTGSA 321 Acinetobacter
WP_004775217 242 AQAQNLLNLLVGQQVPQNLLPQQQVARITKQGVLSAGLPSDLLNNRPDVKASEYQLSAAGANIGAAKAQLFPTISLTGSA 321 Acinetobacter
WP_005055714 322 GYASTDLSDLFKSGNALWSIGPSIDMPIFDWGTRKANVKISETDQKIALSNYEKSIQSAFREVNDALATRANIGDRLTAQ 401 Acinetobacter b...
WP_070075835 322 GYASTDLSDLFKAGNGVWSIGPSLNIPIFDWGTRKANVKISETDQKIALANYEKSVQSAFREVNDALATRANIGDRLTAQ 401 Acinetobacter
WP_004803104 322 GYASTDLSDLFKAGNGVWSIGPSLNIPIFDWGTRKANIKISETDQKIALANYEKSVQSAFREVNDALATRANIGDRLTAQ 401 Acinetobacter s...
WP_023271572 322 GYASTDLSDLFKAGNGVWSIGPSLNIPIFDWGTRKANIKISETDQKIALANYEKSVQSAFREVNDALATRANIGDRLTAQ 401 Acinetobacter g...
WP_005150275 322 GYASTDLSDLFKSGNALWSIGPSLNIPIFDWGTRKANVKISETDQKIALANYEKSVQSAFREVNDALATRANIGDRLTAQ 401 Acinetobacter
WP_016651043 322 GYASTDLSDLFKAGNGAWSIGPSLNIPIFDWGTRKANIKISETDQKIALANYEKSVQSAFREVNDALATRANIGDRLTAQ 401 Acinetobacter c...
WP_005269582 322 GYASTDLSDLFKSGNGVWSIGPSLNIPIFDWGTRKANIKISETDQKIALANYEKSVQSAFREVNDALATRANIGDRLTAQ 401 Acinetobacter c...
WP_005243849 322 GYASTDLSDLFKAGHGAWSIGPSLNIPIFDWGTRKANIKISETDQKIALANYEKSVQSAFREVNDALATRANIGDRLTAQ 401 Acinetobacter
WP_005227056 322 GYASTDLSDLFKSANGLWSIGPSLNIPIFDWGTRKANIKISETDQKIALANYEKSVQSAFREVNDALATRANIGDRLTAQ 401 Acinetobacter
WP_004775217 322 GYASTDLSDLFKSANGLWSIGPSLNIPIFDWGTRKANIKISETDQKIALSNYEKSVQSAFREVNDALATRANIGDRLTAQ 401 Acinetobacter
WP_005055714 402 TRLVEATNTTYKLSNARFRAGIDSYLTVLDAQRSAYSAEQGLLLLQQANLNNQVELYKTLGGGLKANSSETVTQQPSSAE 481 Acinetobacter b...
WP_070075835 402 RRLVDATNTTYKLSNARFRAGIDSYLTVLDAQRSAYSAEQGLLLLQQANLNNQVELYKTLGGGLKASTSETVTHQPSSAE 481 Acinetobacter
WP_004803104 402 RRLVDATNTTYKLSNARFRAGIDSYLTVLDAQRSAYSAEQGLLLLQQANLNNQVELYKTLGGGLKASTSETVTHQPSSSE 481 Acinetobacter s...
WP_023271572 402 RRLVDATNTTYKLSNARFRAGIDSYLTVLDAQRSAYSAEQGLLLLQQANLNNQVELYKTLGGGLKASTSETVTHQPSSSE 481 Acinetobacter g...
WP_005150275 402 RRLVDATNTTYKLSNARFRAGIDSYLTVLDAQRSAYSAEQGLLLLQQANLNNQVELYKTLGGGLKASTSETVAHQPSSSE 481 Acinetobacter
WP_016651043 402 RRLVDATNTTYKLSNARFRAGIDSYLTVLDAQRSAYSAEQGLLLLQQANLNNQVELYKTLGGGLKASTSETVTHQPSSSE 481 Acinetobacter c...
WP_005269582 402 RRLVEATNTTYTLSNARFRAGIDSYLTVLDAQRSAYSAEQGLLLLQQADLNNQVELYKTLGGGVKASTSESVTHQPSSSE 481 Acinetobacter c...
WP_005243849 402 RRLVDATNTTYKLSNARFRAGIDSYLTVLDAQRSAYSAEQGLLLLQQADLNNQVELYKTLGGGIKATTSETITHQPSSSQ 481 Acinetobacter
WP_005227056 402 RRLVDATNTTYKLSNARFRAGIDSYLTVLDAQRSAYSAEQGLLLLQQADLNNQVELYKTLGGGLKASTSETVTHQPSSSQ 481 Acinetobacter
WP_004775217 402 RRLVDATNTTYKLSNARFRAGIDSYLTVLDAQRSAYSAEQGLLLLQQADLNNQVELYKTLGGGLKASTSETVTHQPSSSE 481 Acinetobacter
WP_005055714 482 IR 483 Acinetobacter beijerinckii
WP_070075835 482 QH 483 Acinetobacter
WP_004803104 482 QH 483 Acinetobacter sp. CIP 56.2
WP_023271572 482 QH 483 Acinetobacter gyllenbergii
WP_005150275 482 QH 483 Acinetobacter
WP_016651043 482 QH 483 Acinetobacter colistiniresistens
WP_005269582 482 QH 483 Acinetobacter colistiniresistens
WP_005243849 482 QH 483 Acinetobacter
WP_005227056 482 QH 483 Acinetobacter
WP_004775217 482 QH 483 Acinetobacter
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap