Conserved Protein Domain Family
mfpA_AE000516.2

?
NF000349: mfpA_AE000516.2 
pentapeptide repeat protein MfpA
Statistics
?
PSSM-Id: 411082
Aligned: 2 rows
Threshold Bit Score: 354.368
Created: 20-Oct-2021
Updated: 25-Oct-2021
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_003417767   1 MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLR 80  Mycobacterium t...
WP_003417767   1 MQQWVDCEFTGRDFRDEDLSRLHTERAMFSECDFSGVNLAESQHRGSAFRNCTFERTTLWHSTFAQCSMLGSVFVACRLR 80  Mycobacterium t...
WP_003417767  81 PLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLV 160 Mycobacterium t...
WP_003417767  81 PLTLDDVDFTLAVLGGNDLRGLNLTGCRLRETSLVDTDLRKCVLRGADLSGARTTGARLDDADLRGATVDPVLWRTASLV 160 Mycobacterium t...
WP_003417767 161 GARVDVDQAVAFAAAHGLCLAGG 183 Mycobacterium tuberculosis complex
WP_003417767 161 GARVDVDQAVAFAAAHGLCLAGG 183 Mycobacterium tuberculosis complex
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap