Conserved Protein Domain Family
ATP8

?
MTH00261: ATP8 
ATP synthase F0 subunit 8; Provisional
Statistics
?
PSSM-Id: 177263
View PSSM: MTH00261
Aligned: 2 rows
Threshold Bit Score: 45.6457
Threshold Setting Gi: 200004076
Created: 9-Dec-2010
Updated: 16-Jan-2013
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
164420811  1 MSQLDLSLYFNHYFVLLLLFLILIILLSIKFYNFFLVLNIRNNISCSSLKLNIINPKQFSILQSILKS 68 
200004076  1 MSQLDLSLYLNHYFVLLLLFFLLIILISLRFYNFFLVLNIRNNFISNSSESINNNFKQFSILYNILKL 68 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap