Conserved Protein Domain Family
ATP8

?
MTH00260: ATP8 
ATP synthase F0 subunit 8; Provisional
Statistics
?
PSSM-Id: 164770
View PSSM: MTH00260
Aligned: 7 rows
Threshold Bit Score: 35.588
Threshold Setting Gi: 192288380
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
192288408  1 MPHLSPMTWLIAPILFcSFMLPMIIATLWWTQTPIFPEPLSSSPKITLNNWNWS 54 
5835194    1 MPHLSPMSWITSMLMF-WISVSILFSTLWWSNNYLFSSKMTNCAPKSLTPWNWL 53 
54310657   1 MPHLAPISWLTIMSIS-WFTLLVLAISMWWHQPLQFKATSMKQQLPSFSQWNWS 53 
172088188  1 MPHLAPLSWALASFLF-WFLLLMFVTSIWWSQSPKFSLS-SKMTPPSFSSWNWS 52 
192288380  1 MPHLSPMIWALSPLIFmIFILFFFMSSMWWAQMPKFPKS-YDSNLKTLNKWNWS 53 
150375681  1 MPHLSPMSWLAAIISF-WLILLIFASNGWWSNSHTFDADVTHHAKFSQKFWSWT 53 
238866907  1 MPHLAPISWLTIMSIS-WFTLLVLAISMWWHQPLQFKATSMKQQLPSFSQWNWS 53 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap