Conserved Protein Domain Family
CYTB

?
MTH00224: CYTB 
cytochrome b; Provisional
Statistics
?
PSSM-Id: 164767
View PSSM: MTH00224
Aligned: 4 rows
Threshold Bit Score: 622.712
Threshold Setting Gi: 54310665
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5835197     1 MFKPIRTTHPAIKIINSTLIDLPAPNNISIWWNYGSLLGLCLVIQVLTGLFLSMHYVPNIEMAFSSVALISRDVNYGWLL 80 
238866915   1 MFKPFRQEHPLIKILNGSLIDLPAPKNLSIWWNFGSLLGLCLIIQILTGLFLAMHYAPHVDLAFSSVAHISRDVNYGWLL 80 
54310665    1 MFKPFRQEHPLIKILNGSLIDLPAPKNLSIWWNFGSLLGLCLIIQILTGLFLAMHYAPHVDLAFSSVAHISRDVNYGWLL 80 
150375684   1 MFKPLRTTHPALKIVNGSLIDLPAPNNISIWWNYGSLLGLCLVIQVATGLFLSMHYAPNIEMAFSSVAHISRDVNYGWLL 80 
5835197    81 RSIHANGASMFFLFIYLHAGRGLYYGSYNLSETWNIGVILFLLTMATAFMGYVLPWGQMSFWGATVITNLFSAIPYIGKT 160
238866915  81 RATHINAASMFFACIYLHVGRGLYYGSFRYVETWNIGVIIMIITMATAFLGYVLPWGQMSFWGATVITNLLSAIPYIDPD 160
54310665   81 RATHINAASMFFACIYLHVGRGLYYGSFRYIETWNIGVIIMIITMASAFLGYVLPWGQMSFWGATVITNLLSAIPYIGPD 160
150375684  81 RSIHANGASMFFLFIYIHIGRALYYGSFNLHETWNIGVILFVLTMATAFTGYVLPWGQMSFWGATVITNLFSAIPYIGKS 160
5835197   161 LVEWIWGGFAVDNATLNRFFAFHFILPFAIMGATILHIMFLHESGSNNPIGLNADSDRIPFHPYYSIKDTLGYTLAISAL 240
238866915 161 IVQWLWGGFAVDNATLNRFFSLHFLLPFLLVAASAVHLLFLHQTGSNNPLGIKSEQARVKFHPYYTTKDALGFLIALLLL 240
54310665  161 IVQWLWGGFAVDNATLNRFFSLHFLLPFLLVAASAVHLLFLHQTGSNNPLGIKSEQARVKFHPYYTTKDALGFLIALLLL 240
150375684 161 LVEWIWGGFAVDNATLNRFFSFHFVLPFAIMGATILHIMFLHQTGSNNPIGVNADSERIPFHSYYSIKDALGYLIAITGL 240
5835197   241 SLMVLFEPNLFTDPENFLMANPLVTPIHIKPEWYFLWMYAILRSIPNKLGGVMALFAAIVILFIPPLTSvmnKRSLSFYP 320
238866915 241 SLIVLFFPDALADPDNFIPANPLVTPVHIKPEWYFLWAYAILRSIPNKLGGVVALFSALLILFTLPLGP---QTPAPFYP 317
54310665  241 SLIVLFFPDALADPDNFIPANPLVTPVHIKPEWYFLWAYAILRSIPNKLGGVVALFSALLILFTLPLGP---QTPSPFFP 317
150375684 241 TMMVLFEPNLFTDPENFLMANPLVTPIHIKPEWYFLWMYAILRSIPNKLGGVLALFAGILVMFILPMTSnsnKRSLTFYP 320
5835197   321 LNKTMFWGLVASWAILTWIGGRPVEDPFIIIGQVFTSLYFIYFISSPTISKLWDDSIII 379
238866915 318 LNQLLFWLLVTTFMVLTWIGGCPVEAPFEGIGQVFTITYFSLYIIAPASSLAWNRLLNA 376
54310665  318 LNQLLFWLLVTTFMVLTWIGGCPVEAPFEGIGQIFTVTYFSLYIITPASSVIWKQILNA 376
150375684 321 LNQLLFWIFVTSWAILTWIGGRPVEDPFVTIGQTFTILYFTYFIMNPLITKSWDTLCKS 379
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap