Conserved Protein Domain Family
COX1

?
MTH00223: COX1 
cytochrome c oxidase subunit I; Provisional
Statistics
?
PSSM-Id: 177260
View PSSM: MTH00223
Aligned: 78 rows
Threshold Bit Score: 805.738
Threshold Setting Gi: 68989134
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
84488575   21 RRWLWSTNHKDIGTLYLYSGVWGGLFGASLSLMIRMQLGHPGAvFLKSDWFYNVVVTTHALMMIFFAVMPILIGAFGNWL 100
153123678   1 ----MANSHKDVGTMYLMLGMWSGFGGLNLSWMMRLELSRPGM-WLPSSEVYNGIVTLHAIMMIFFFVMPVLIGGFGNWL 75 
68989134   31 ESAVMSTNHLDIGSFYMIFGFWAVLAGTSFSSLIRWSLYTPGA-KFLEPVVYNAVVTSHALVMIFFFVMPVMIGGFGNWL 109
7212457     1 ----MSTNHLDIGSFYMVFGFWAVLAGTSFSSLIRWSLYNPGA-KFLDPVTYNAVVTSHALVMIFFFVMPVMIGGFGNWL 75 
229324832  30 RGTFMSTNHLDIGSFYMVFGFWAVLAGTSFSSLIRWSLYNPGA-KFLDPVTYNAVVTSHALVMIFFFVMPVMIGGFGNWL 108
229324852  30 RGTFMSTNHLDIGSFYMVFGFWAVLAGTSFSSLIRWSLYNPGA-KFLDPVTYNAVVTSHALVMIFFFVMPVMIGGFGNWL 108
229328221  30 RGTFMSTNHLDIGSFYMVFGFWAVLVGTSFSSLIRWSLYTPGA-KFLDPVTYNAVVTSHALVMIFFFVMPVMIGGFGNWL 108
254033633   1 ----MANSHKDVGTMYLMLGMWSGFGGLNLSWMMRLELSRPGM-WLPSSEVYNGIVTLHAIMMIFFFVMPVLIGGFGNWL 75 
281190776  30 RGTFMSTNHLDIGSFYMVFGFWAVLAGTSFSSLIRWSLYNPGA-KFLDPVTYNAVVTSHALVMIFFFVMPVMIGGFGNWL 108
292496224  31 RGTFMSTNHLDIGSFYMVFGFWAVLAGTSFSSLIRWSLYNPGA-KFLDPVTYNAVVTSHALVMIFFFVMPVMIGGFGNWL 109
84488575  101 IPLLVGGKDMIYPRMNNLSYWLSPNALYLLMLSFSTDKGVGAGWTIYPPLSVYPYHSGPSMDVLIVSLHLAGLSSLVGAI 180
153123678  76 LPMMLGAIDMSFPRLNTFSFWVLPPALYLVIVSCFIDYGSGTGWTMYPPLSSTPYSGGMSTDLMILGLHLAGISSSAASI 155
68989134  110 IPLMLEVADMQFPRLNAFSFWVLPGSLLLMLMSNMSESGVGSGWTIYPPLST-FSYHGVCMDFAILSLHLAGISSIFSSI 188
7212457    76 IPLMLLVADMQFPRLNAFSFWVLPGSLYLMLMSNIVENGVGAGWTIYPPLST-YSYHGVCMDLAILSLHLAGISSIFSSI 154
229324832 109 IPLMLQVADMQFPRLNAFSFWVLPGSLYLMLMSNIVENGVGAGWTIYPPLST-YSYHGVCMDLAILSLHLAGISSIFSSI 187
229324852 109 IPLMLQVADMQFPRLNAFSFWVLPGSLYLMLMSNIVESGVGAGWTIYPPLST-YSYHGVCMDLAILSLHLAGISSIFSSI 187
229328221 109 IPLMLQVADMQFPRLNAFSFWVLPGSLYLMLMSNLVESGVGAGWTIYPPLST-YSYHGVCMDLAILSLHLAGISSIFSSI 187
254033633  76 LPMMLGAIDMSFPRLNTFSFWVLPPALYLVIVSCFIDYGSGTGWTMYPPSSSTPYSGGMSTDLMILGLHLAGISSSAASI 155
281190776 109 IPLMLQVADMQFPRLNAFSFWVLPGSLYLMLMSNLVESGVGAGWTIYPPLST-YSYHGVCMDLAILSLHLAGISSIFSSI 187
292496224 110 IPLMLQVADMQFPRLNAFSFWVLPGSLYLMLMSNLVENGVGAGWTIYPPLST-YSYHGVCMDLAILSLHLAGISSIFSSI 188
84488575  181 NFASTNKNMPVLEMKGERAELYVLSISVTAVLLIISIPVLGGGITMILFDRNFNTTFFDPAGGGDPVLFQHLFWFFGHPE 260
153123678 156 NYLVTFLNVRSKTFKAEYCPPFVWALSVTSFLLLVSLPVLAGGLTMLIMDRHFNCSFFDPSGGGDPVLFQHLFWFFGHPE 235
68989134  189 NFMVTISNMRSVGGHM--LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVLFQHLFWFFGHPE 266
7212457   155 NFMVTISNMRSVGGHL--LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVLFQHLFWFFGHPE 232
229324832 188 NFMVTISNMRSVGGHL--LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVLFQHLFWFFGHPE 265
229324852 188 NFMVTISNMRSVGGHL--LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVLFQHLFWFFGHPE 265
229328221 188 NFMVTISNMRSVGGHL--LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVLFQHLFWFFGHPE 265
254033633 156 NYLVTFLNVRSKTFKAEYCPPFVWALSVTSFLLLVSLPVLAGGLTMLIMDRHFNCSFFDPSGGGDPVLFQHLFWFFGHPE 235
281190776 188 NFMVTISNMRSVGGHL--LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVLFQHLFWFFGHPE 265
292496224 189 NFMVTISNMRSVGGHL--LALFPWSIKVTSFLLLTTLPVLAGGLTMLLTDRHFNTSFFDPVGGGDPVLFQHLFWFFGHPE 266
84488575  261 VYILILPAFGVMSKVIMHCSGKEAVFGLIGMVYAMIGIGGLGCMXWAHHMFTVGLNVDTRGYFSTATMVIAVPTGVKVFS 340
153123678 236 VYVLILPGFGLVSHVLVFYTKKLRVFGSVAMMYAMISIGVLGFIVWGHHMYTVGLDVDTRFYFTAVTMLIAVPTGVKVFS 315
68989134  267 VYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATVIIAVPTGIKVFA 346
7212457   233 VYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATVIIAVPTGIKVFA 312
229324832 266 VYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATVIIAVPTGIKVFA 345
229324852 266 VYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATVIIAVPTGIKVFA 345
229328221 266 VYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATVIIAVPTGIKVFA 345
254033633 236 VYVLILPGFGLVSHVLVFYTKKLRVFGSVAMMYAMISIGVLGFIVWGHHMYTVGLDVDTRFYFTAVTMLIAVPTGVKVFS 315
281190776 266 VYVLILPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATVIIAVPTGIKVFA 345
292496224 267 VYVLIIPGFGMISHVLCFWSSKKTAYGNMGMFYAMLNIGFLGFIVWGHHMFVAGMDIDTRAYFSAATVIIAVPTGIKVFA 346
84488575  341 WLATMAGSKFKMKPAAYWSTGFLFLFTVGGLTGVLLSSASMDVSLHDTYYVVAHFHYVLSMGAVFGVFCGLNHWLPNFVG 420
153123678 316 WIATIYGSHLSFEAPVLWVLGFIVKFTMGGITGVILSNACLDVALHDTYYVVAHFHYVLSMGAVFTIFAGYVHYFPLFTG 395
68989134  347 WISTMLGSKVSTQAPMLWATGFIVLFTIGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTILAGFTHWFPLVAK 426
7212457   313 WISTMLGSKVSTQAPMLWSTGFIILFTTGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTILAGFTHWFPLVAK 392
229324832 346 WISTMLGSKVSTQAPMLWSTGFIILFTTGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTILAGFTHWFPLVAK 425
229324852 346 WISTMLGSKVSTQAPMLWSTGFIVLFTTGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTILAGFTHWFPLVAK 425
229328221 346 WISTMLGSKVSTQAPMLWSTGFIVLFTIGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTILAGFTHWFPLVAK 425
254033633 316 WIATIYGSHLSFEAPVLWVLGFIVKFTMGGITGVILSNACLDVALHDTYYVVAHFHYVLSMGAVFTIFAGYVHYFPLFTG 395
281190776 346 WISTMLGSKVSTQAPMLWSTGFIVLFTTGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTILAGFTHWFPLVAK 425
292496224 347 WISTMMGSKASTQAPMLWSTGFIILFTTGGLTGLILSSASVDVTLHDTYFVTGHFHYVLSMGAVFTILAGFTHWFPLVAK 426
84488575  421 VCFNKKWSKAHFMAMFFGVNTTFFPQHFLGLSGMPRRYMDYADIYAHWHWVSSYGSAVSFGSLMYFKFLLWEALVSQRGV 500
153123678 396 NCLHRSWARGHFFLTFVGVNLTFFPQHFLGLGGMPRRIPDYPIFYYYWNQWSTIGCAMVMVSVSLFIFMQWEAFFSGRRP 475
68989134  427 VMMHRQKLKSHFLAMFLGVNLAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTASLLFFVFLLWESFIAQRPV 506
7212457   393 VMMHRQKMKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTGSLLFFVFLLWESFIAQRPV 472
229324832 426 VMMHRQKMKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTGSLLFFVFLLWESFIAQRPV 505
229324852 426 VMMHRQKMKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTGSLLFFVFLLWESFIAQRPV 505
229328221 426 VMMHRQKLKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKISTFGSHLSTGSLLFFVFLLWESFIAQRPV 505
254033633 396 NCLHRSWARGHFFLTFVGVNLTFFPQHFLGLGGMPRRIPDYPIFYYYWNQWSTIGCAMVMVSVSLFIFMQWEAFFSGRRP 475
281190776 426 VMMHRQKLKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTGSLLFFVFLLWESFIAQRPV 505
292496224 427 VMMHRQKMKSHFLAMFLGVNAAFLPHHFLGLAGMPRRVVDYPDHFWFWNKVSTFGSHLSTASLLFFVFLLWESFIAQRPV 506
84488575  501 VFSGGLCGEMDWagtRDLYPGSKHVYSQLPFVWTNP 536
153123678 476 LLVGNRPSSLEWvvnRGFSCVARHTFTEVMALRIMH 511
68989134  507 VSVRNSSSSPEW---AVVASLPKHAGDELAKIIKLP 539
7212457   473 ISVRNTSSSPEW---AVVSSLPKHAGDELAKMAKLC 505
229324832 506 ISVRNTSSSPEW---AVVSSLPKHAGDELAKMAKLC 538
229324852 506 VSVRNTSSSPEW---AVVSSLPKHAGDELAKMAKLC 538
229328221 506 VSVRNTSSSPEW---AVVSSLPKHAGDELAKMAKLC 538
254033633 476 LLVGNRPSSLEWvvnRGFSCVARHTFTEVMALRIMH 511
281190776 506 VSVRNTSSSPEW---AVVSSLPKHAGDELAKMTKFC 538
292496224 507 ISVRNTSNSPEW---SVVSSLPKHAGDELGKMAKLC 539
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap