Conserved Protein Domain Family
ATP9

?
MTH00222: ATP9 
ATP synthase F0 subunit 9; Provisional
Statistics
?
PSSM-Id: 164765
View PSSM: MTH00222
Aligned: 26 rows
Threshold Bit Score: 79.8934
Threshold Setting Gi: 164421045
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
164421189  1 MSELMDAARYIGAGAATIGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAILGFAISEAMGLFCLMMAFLLLFAL 77 
164421217  2 TTEILSASKFIGAGAATIGVAGSGAGIGTVFGNLIIGYARNPSLKQQLFTYAILGFAISEAMGLFCLMMAFLILFAL 78 
164421153  2 TPEILSAAKFVGAGAATIGAAGSGAGIGTVFGNLIIGYSRNPSLKQQLFTYAILGFALSEAMGLFCLMMAFLLLYAF 78 
164420946  2 AAEILSAAKFIGAGAATIGAAGSGAGIGAVFGNLIIGYARNPSLKQQLFTYAILGFALSEVMGLFCLMMAFLILFAL 78 
164420961  2 AAEILSAAKFIGSGAATIGAAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAIMGFALSEAMGLFCLMMAFLILFAL 78 
164420990  2 TPEILSAAKFVGAGAATIGAAGSGAGIGTVFGNLIIGYSRNPSLKQQLFTYAILGFALSEAMGLFCLMMAFLLLYAF 78 
164421030  2 TVEILSAAKFVGAGAATIGAAGSGAGIGSVFGNLIIGYARNPSLKQQLFTYAILGFALSEAMGLFCLMMAFLILFAL 78 
164421045  1 MSEL--SAKFIGAGAATVGAAGSGAGIGTVFGSLIIGYARNPSLKQQLFTYAIFGFALSEAMGLFCLMMAFLILFGL 75 
189095566  2 RDNLTFCAKLIGAGAATIGVAGRGAGIGTVFGNLIIGYARNPKLKQQLFTYAILGFAISEAMGLFCLMMAFLILYGI 78 
126695330  1 MTEL--SAKFIGAGAATVGAAGSGAGIGTVFGSLVIGYARNPSLKQQLFTYAILGFALSEAMGLFCLMMAFLILFGL 75 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap