Conserved Protein Domain Family
ND1

?
MTH00216: ND1 
NADH dehydrogenase subunit 1; Provisional
Statistics
?
PSSM-Id: 164761
View PSSM: MTH00216
Aligned: 34 rows
Threshold Bit Score: 461.126
Threshold Setting Gi: 109156544
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
20065785    1 MFVEIIHLLLKILMVVVPLLITVAYLTLAERKVLGYMQARKGPNVVGVSGLAQPFADGLKLFTKEMVVPHQTNLFIYIVA 80 
124286762   1 MVVTIIHQIIKILVIVVPLLVAVAYLTLAERKVLGYMQARKGPNVVGVYGLLQPLADGVKLFAKEMVIPHHANLFIYVAA 80 
109156558   1 MIVEIIHLILKILLIVVPLLIAVAYLTLAERKVLGYMQARKGPNVVGVYGLLQPLADGIKLFTKELVIPHHANLFIYIAA 80 
109156444   1 MMSTIISIIFKTLAIIIPLLVAIAYLTLAERKVLGYMQARKGPNVVGVYGLLQPLADGLKLFTKEMAIPNHANLSVYIVA 80 
107736211   1 MMSTIISIIFKTLAIIIPLLVAIAYLTLAERKVLGYMQARKGPNVVGVYGLLQPLADGLKLFTKEMVIPNHANLSVYIVA 80 
115494869   1 MMVAIIYFILKILVIVVPLLIAVAYLTLAERKVLGYMQARKGPNVVGVYGLLQPLADGVKLFTKEMVIPHHANLFIYIVA 80 
189095614   1 MMSTIISIIFKTLAIIIPLLVAVAYLTLAERKVLGYMQARKGPNVVGVYGILQPLADGLKLFSKEMVIPNHANLSVYIVA 80 
192293780   1 MMSTIISIIFKTLAIIIPLLVAVAYLTLAERKVLGYMQARKGPNVVGVYGILQPLADGLKLFSKEMVIPNHANLSVYIVA 80 
159106771   1 MIIETIHIILKILIIVIPLLVAVAYLTLAERKVLGYMQARKGPNVVGVYGLLQPLADGIKLFTKELVIPHYANLFIYVAA 80 
164420819   3 NLYFILLEIIKLLIIIIPVLISVAYLTLAERKILGYSQNRKGPNVVGVYGLLQPLADGVKLFSKELIIPNHVNIFLYLFS 82 
20065785   81 PVLSFTLALIVWGVVPYERGALISDLKIGVLYILAVSSISVYAILMSGWASNSKYAFLGAIRAAAQMISYEVSIGLIIIS 160
124286762  81 PILSFTLALIAWGVIPYERGVLISDLKIGILYSLAVSSISVYAILMSGWSSNSKYAFLGAIRAAAQMVSYEVSIGLIIIT 160
109156558  81 PVLSFTLALIAWGVIPYDRGVAISDLKIGILFLLAVSSISVYAILMSGWASQSKYAFLGAIRAAAQMISYEVSIGLIIIT 160
109156444  81 PILSLTLAFLAWGAIPFSPGIVLADINVGILYIFAISSIGVYAILMSGWGSNSKYAFLGAIRAAAQMISYEVCIGLILIS 160
107736211  81 PILSLTLAFLAWGVIPFSPGVVLADINVGILYIFAISSMGVYAILMSGWGSNSKYAFLGAIRAAAQMISYEVCIGLILIS 160
115494869  81 PILSFTLALIAWGVIPYERGVLISDLKIGILYLLAVSSISVYATLMSGWASQSKYAFLGAIRAAAQMISYEVSIGLIIIS 160
189095614  81 PILSLTLAFLAWGVIPFSPGIVLADINVGVLYIFAVSSMGVYAILMSGWGSNSKYAFLGAIRAAAQMISYEVCIGLILIS 160
192293780  81 PILSLTLAFLAWGVIPFSPGIVLADINVGVLYIFAVSSMGVYAILMSGWGSNSKYAFLGAIRAAAQMISYEVCIGLILIS 160
159106771  81 PVLSFTLALIAWGVIPYDKGVVISDLKIGILFTLAVSSISVYAILMSGWASQSKYAFLGAIRAAAQMISYEVSIGLIIIT 160
164420819  83 PILALTLSLVIWIIIPLGNNNLIFDFNLGIMFIFAISSINIYSILLSGWSSNSKYAFLGSLRAAAQMISYEVCISLIIFS 162
20065785  161 VLLCVGSLSVTEIVLAQNSGVWFFFPLFPVTIMFFVSALAETNRAPFDLTEGESELVSGYNVEYASMSFALFFLAEYAHI 240
124286762 161 VILCVGSLNITEIVLAQGNSVWFFFPLFPAAMMFFASALAETNRAPFDLTEGESELVSGYNVEYASMSFALFFLAEYAHI 240
109156558 161 VILCVGSLNISEIVLAQSNGTWFIFPLFPAAMMFFASALAETNRAPFDLTEGESELVSGYNVEYASMSFALFFLAEYAHI 240
109156444 161 VILCAGSLNITQIVLAQ-AEIWYIIPLFPAALMFFASALAETNRAPFDLTEGESELVSGYNVEYSSMSFALFFLAEYGHI 239
107736211 161 VILCAGSLNITQIVLAQ-AEIWYIIPLFPAALMFFASALAETNRAPFDLTEGESELVSGYNVEYSSMSFALFFLAEYGHI 239
115494869 161 VILCVGSFNIIEIVLAQSNGVWFLFPLFPAAIMFFASALAETNRAPFDLTESESELVSGYNVEYASMSFALFFLAEYAHI 240
189095614 161 VILCAGSLNIPQIVLAQ-AEIWYIIPLFPAALMFFASALAETNRAPFDLTEGESELVSGYNVEYSSMSFALFFLAEYGHI 239
192293780 161 VILCAGSLNIPQIVLAQ-AEIWYIIPLFPAALMFFASALAETNRAPFDLTEGESELVSGYNVEYSSMSFALFFLAEYGHI 239
159106771 161 VILCVGSLNITEIVLAQSSGIWFFFPLFPVAMMFFASALAETNRAPFDLTEGESELVSGYNVEYASMSFALFFLAEYAHI 240
164420819 163 CILCSGSLNISSLINCQSQSISYIFPLWPIAIMFFICSLAETNRAPFDLTEGESELVSGYNVEYSSMSFALFFLAEYSHI 242
20065785  241 ILMSCLTIIFFGGGWLSPVKYLKGGAGWFGLKVVLIIFLFIWVRASFPRIRYDQLMSLLWKAYLPLSLGVVTFVASVLFG 320
124286762 241 ILMSCMTTILFLGGWLSPIMFLKGGPWWFGLKTAFIILLFIWIRASFPRMRYDQLMALLWKSYLPLSLALVVLVAGVLLG 320
109156558 241 ILMSCLTTILFLGGWLSPIPFLKGGAIWFGFKASFIILLFVWVRASFPRMRYDQLMALLWKSYLPLSLAFVILVAGLLFG 320
109156444 240 ILMSCLISLLFLGGWAPFTGIL--GMGCLALKTTAVVFAFVWVRASFPRMRYDQLMYLLWKSYLPFSLGLVVLVSGLLIG 317
107736211 240 ILMSCLISLLFLGGWAPFTGIL--GMGCLALKTTAIVFTFVWVRASFPRMRYDQLMYLLWKSYLPFSLGLIVLVSGLLIG 317
115494869 241 ILMSCLTTILFLGGWLSPIPYFRGGAGWFGLKAALIILLFIWVRASFPRMRYDQLMALLWKSYLPLSLAFVVLVASVLLG 320
189095614 240 ILMSCLMSLLFLGGWAPFTGII--GMGCLALKTTAVVFAFVWVRASFPRMRYDQLMYLLWKSYLPFSLGLVVLVSGLLIG 317
192293780 240 ILMSCLMSLLFLGGWAPFTGII--GMGCLALKTTAVVFAFVWVRASFPRMRYDQLMYLLWKSYLPFSLGLVVLVSGLLIG 317
159106771 241 ILMSCLTTILFLGGWLSPIVFFKGGPAWFGLKTSFIILLFIWVRASFPRMRYDQLMALLWKSYLPLSLAFVVLVASLLFG 320
164420819 243 IFTSAFFVILFLGSWNN---YFFINNLIFFTKLILFTFFFIWIRTSFPRLRYDQLMGLLWKSYLPLSLSFIIFTNSLLWA 319
20065785  321 LNGPPPI 327
124286762 321 FNGLPPS 327
109156558 321 LNGLPPF 327
109156444 318 LDAVPC- 323
107736211 318 LDAVPC- 323
115494869 321 FNGLPPS 327
189095614 318 LGAVPFM 324
192293780 318 LGAVPFM 324
159106771 321 LNGLPPS 327
164420819 320 FWGLSYK 326
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap