Conserved Protein Domain Family
ND5

?
MTH00210: ND5 
NADH dehydrogenase subunit 5; Provisional
Statistics
?
PSSM-Id: 177253
View PSSM: MTH00210
Aligned: 26 rows
Threshold Bit Score: 918.246
Threshold Setting Gi: 281428844
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
170676861   1 MYILVVFLPLLSAIISGLFGRKIGTKGAGVLTSSCMVISALVSCCIFYETVLNSSAAYIKLWRWFDSELFTAYFGLQFDS 80 
164421148   1 MYILVLFVPLLSAVISGLFGRIIGTRGAGIFTSSCIVISVIISCFIFYETTLNVSPVYIKLWRWFDSELFTGSFGLQFDS 80 
164421202   1 MIMCILCFPLMGAILAGLWGRKLGSRGSSYWLVLLVFCGFLVLLKGMWDIR-EGGAIYVEFESWIKAGFVEINWGFYVDY 79 
164420985   1 MYILIIFLPLLSAVISGLFGRTIGTRGASILTSSCIVLSFIISCLIFYETTLNVSPVYIKLWRWFDSELFTGSFGLQFDS 80 
126695324   1 MYLLVLFIPLLSAAISGLFGRKIGEKGAGVFTSSSIVISWVLSMLIFYETNINTSPTYIKLWRWFDSELLTTYFGLQFDA 80 
164421187   1 MYILILFLPLLSAIVSGLFGRKIGTKGAGIFTSNCIIISFLLSCYMYYEIILNFSPAYIRLWRWFDSELFTTYFGLQFDN 80 
164421142   1 MYMLILFLPLLSAIVSGLFGRKIGTKGAGIFTSNCIIISLIVSCYIYYEAILNLSPTYVGLWRWFDSELFTTSFGLQFDG 80 
124484820   1 MYVLVLWLPLVSAIISGLWGRKIGTRGAGRLTSTCIILCWGVSCIILYEVCLNGAATYIQLWKWFDFELLTVSFGLQIDV 80 
164421039   1 MYILILFLPLLSAFISGLFGRKIGAKGAGIFTSSCITLTIIISCFIFYETTLSLSTTYLKLWRWVDSDLLSTDFGLQFDS 80 
164421216   1 MYLLIIFITFLSASVTGLFGRKIGTKGAGLFSSICIIISAGVAYYIFYEVVLCGSVVFLKLGKWINTDILIISFGLQFDS 80 
170676861  81 LTSVMLIVVTSVSAFVHIYSTGYMSGDPHIPRFMSYLSLFTFLMIVLVTSENYVQLFIGWEGVGLCSYLLINFWLTRIKA 160
164421148  81 LTASMLFVITSVSALVHIYSMGYMEGDPHVPRFMSYLSFFTFLMIVLVTSDNYIQLFIGWEGVGLCSYLLINFWFTRIKA 160
164421202  80 VTIAMMFIIMIVSGLVHLYSIGYMEGDPHVSRFMSYLSLFTFFMLVLVTSHNYLQLFIGWEGVGLCSYLLINFWGTRLAA 159
164420985  81 LTASMLFVITSVSALVHIYSTGYMEGDPHIPRFMSYLSFFTFLMIVLVTSDNYIQLFIGWEGVGLCSYLLINFWFTRIKA 160
126695324  81 LTGTMLVVITSVSALVHIYSTGYMSGDPHIPRFMSYLSLFTFFMIVLVTSDNYVQLFIGWEGVGLCSYLLINFWLTRIQA 160
164421187  81 LTATMLIIITSISALVHIYSIGYMAGDPHIPRFMAYLSLFTFLMIVLVTSDNYLQLFIGWEGVGLCSYLLINFWLTRIKA 160
164421142  81 LTAAMLIVITSISALVHIYSVGYMAGDPHIPRFMSYLSLFTFLMIILVTSDNYLQLFIGWEGVGLCSYLLINFWLTRIKA 160
124484820  81 ISSVMLIVVTSVSLLVHIYSTGYMKGDPHVPRFMAYLSLFTFLMIVLVTSDNYLQLFIGWEGVGVCSYLLINFWLTRIRA 160
164421039  81 LTAIMLIVITSVSALVHIYSTGYMAGDPHVPRFMSYLSLFTFLMIVLVTSDNYIQLFIGWEGVGLCSYLLINFWFTRIKA 160
164421216  81 LTAIMLVIITSISAMVHIFSLGYMKEDPHIPRFMSYLSLFTFLMIVLVTSDNYLQLFIGWEGVGLCSYLLINFWFTRIQA 160
170676861 161 NKAAMKAMLINRVGDIGLILAMIKILAEFGSLDFSTIYSIMSLNewgeaysnsvaVNKDSLTIICLLLFLGAVGKSAQLG 240
164421148 161 NKAAIKAMLVNRVGDIGLVLAMFLILREFGSLEFSIINNLLI-------------IESKSSNIICFLLFVGAIGKSAQLG 227
164421202 160 NKAAIKAMLVNRVGDMGLIIGMIFLLNQYDTLEYGLLSVLYE-------------IGDSKLEVIGFCLLVGAVGKSAQLG 226
164420985 161 NKAAIKAMLVNRVGDIGLVLAMFLILREFGSLEFSIINNLLV-------------IGSESSNIICFLLFVGAIGKSAQLG 227
126695324 161 NKAAIKAMLVNRVGDIGLVLGMFAIFKEFGSLEFSTVFSAINEI-----------SRPNSIALICILLLIGAVGKSAQLG 229
164421187 161 NKAAIKAMLINRVGDLGLVIALIMIFKEFGTLDFSIISSSLITFe----------INNNSLTIICLLLFIGAIGKSAQLG 230
164421142 161 NKAAIKAMLINRVGDLGLILALVMIFKEFGTLDFSIISSLLVTLd----------INKNSLTTICLLLFIGAIGKSAQLG 230
124484820 161 NRAAMKAMLVNRMGDIGVVLAMLLMYREFGTLDFSTLSGLSG-------------TDAPHMTAICLLLLMGAVGKSAQLG 227
164421039 161 NRAAIKAMLVNRVGDIGLVLAMIMLIKEFGTLEFSVINGILIGP-----------INNINLTIICLLLFLGAIGKSAQLG 229
164421216 161 NKAAIKAMLINRVGDMGLILAIFLILKYFGSLEFEILSNIYLEE-----------NSKQIIEIICLLLFIATIGKSAQLG 229
170676861 241 LHTWLPDAMEGPTPVSALIHAATMVTAGVFLIIRSGPLFEGSPFALTVVTILGALTAFFAATTGVVQNDLKKVIAYSTCS 320
164421148 228 LHTWLPDAMEGPTPVSALIHAATMVTAGVFLIIRSAPLFEFAPFILIFVTIIGALTAFFAATTGVVQNDLKKVIAYSTCS 307
164421202 227 LHTWLPDAMEGPTPVSALIHAATMVTAGVFLIIRSADLFVHCSMVLILMGVIGSLTAFFAGTVGLVQGDLKKVIAYSTCS 306
164420985 228 LHTWLPDAMEGPTPVSALIHAATMVTAGVFLIIRSAPLFEFAPFALTFVTIIGALTAFFAATIGVVQNDLKKVIAYSTCS 307
126695324 230 LHTWLPDAMEGPTPVSALIHAATMVTAGVFLIMRSGPLFEGSPLALTITMVVGALTAFFAATVGLVQNDLKKVIAYSTCS 309
164421187 231 LHTWLPDAMEGPTPVSALIHAATMVTAGVFLIIRSSSLFECSSIALVVVTIIGALTAFFAATVGVVQNDLKKVIAYSTCS 310
164421142 231 LHTWLPDAMEGPTPVSALIHAATMVTAGVFLIIRSSALFECSSVALIIVTILGAMTAFFAATVGVVQNDLKXVIAYSTCS 310
124484820 228 LHTWLPDAMEGPTPVSALIHAATMVTAGVYLIIRSGPLFEKSPMALTVVTIIGALTAFFAATTGVVQNDLKKVVAYSTCS 307
164421039 230 LHTWLPDAMEGPTPVSALIHAATMVTAGVFLIIRSAPLFEKTPLTLIFVTIMGALTAFFAATSGLVQNDLKKVIAYSTCS 309
164421216 230 LHTWLPDAMEGPTPVSALIHAATMVTAGVFLVIRSAFLFETAPLISILMSVIGGLTAFISATIGLVQNDLKKVIAYSTCS 309
170676861 321 QLGYMVMVCGLSNYSTSLFHLMNHAFFKALLFLSAGSVIHAVSDEQDMRKMGGLLKSVPFTYTMILIGSLSLMGFPYLTG 400
164421148 308 QLGYMVMVCGLSNYSTSLFHLMNHAFFKALLFLSAGSVIHAVSDEQDMRKMGGLIRSIPLTYILILIGSLSLMGFPYLTG 387
164421202 307 QLGLMVLACGCLCFSSALYHLVNHAFFKALLFLSAGSLIHGLGDXQDMRKFGGFKGVMPITYVGILVGSLSLMGVPYLTG 386
164420985 308 QLGYMVMICGLSHYSTSLFHLMNHAFFKALLFLSAGSVIHAVSDEQDMRKMGGLIGSIPLTYILMLIGSLSLMGFPYLTG 387
126695324 310 QLGYMVMVCGISNYSTSLFHLMNHAFFKALLFLSAGSVIHALADEQDMRKMGGLIRSIPFTYVMILIGSLSLMGFPYLTG 389
164421187 311 QLGYMVMVCGISGYSVGLFHLFNHAFFKALLFLSAGSIIHAVSDEQDMRKMGALIKTIPFTYIMILIGSLSLMGFPYLTG 390
164421142 311 QLGYMIMICGISNYSVSLFHLVNHAFFKALLFLSAGSIIHAVSDEQDMRKMGALIKSIPFTYTMVTIGSLSLMGFPYLTG 390
124484820 308 QLGYMVMVCGISGYSTSLFHLMNHAFFKALLFLSAGSAIHAIGDEQDMRKMGGLLRAIPITYVSILIGSMSLMGFPYLTG 387
164421039 310 QLGYMVMVCGISNYSISLFHLMNHAFFKALLFLSAGSVIHAVNDEQDLRKMGGLLKSIPLTYVMVLIGSLSLMGFPYLTG 389
164421216 310 QLGYMVMICGVSYYSVSLFHLVNHAFFKALLFLSAGAIIHAVNDEQDIRKMGGLIKPLPLIFIITMIGALSLMGTPYLTG 389
170676861 401 FYSKDLILELTFDKYYVAFAYWLGSFSALLTAFYSMRLIYLTFMTDTNLKKETLTKVHESTWTITLPLLLLAFGSIFVGY 480
164421148 388 FYSKDLILELTYNKYYMAFAYWLGSISALLTAFYSTRLIYLTFFTNTNSRKETLVGVHEPSFNIIYPLIFLAFGSIFIGY 467
164421202 387 FYSKXVGLELVYGEYMWGLIYWLGVGSVCLTGAYSGRLIYWVFLGQPRGSWLKYRGVYEGNWCILIPLVILSVGSIIVGY 466
164420985 388 FYSKDLILELAYNKYYMAFAYWLGSLSALLTAFYSTRLIYLTFLTNTNSRKETLVGVHEPSLNILFPLVLLAFGSLFIGY 467
126695324 390 FYSKDLILELVYDKYYLAFAYWLGAFSALLTAFYSIRLIYLTFISNTNSRKEVLMNVHESSWNITLPLLLLALGSIFVGY 469
164421187 391 FYSKDLILELSFEKYYIILAFWLASSAAFLTAFYSIRLIYFTFIINSNAPKEVFLKIHESSKIILFPLALLAFGGIFLGY 470
164421142 391 FYSKDLILELSFDRYYIIFAFWLASFAAFLTAFYSVRLVYLAFLTNSNASKEVFYKIHESSLVILFPLLLLALGSIFVGY 470
124484820 388 FYSKDLILELIYGRYYIAFAYWLGSVSALLTAFYSMRLVYLTFMTETNARQGSWDNVRESSRAITVPLCILALGSIFVGY 467
164421039 390 FYSKDLILELLFDKYYIAFAYWLGSISALLTAFYSIRLIYFTFLTNPNSKKEVLINAHESSLNILFPLFFLALGSIFVGY 469
164421216 390 FYSKDLILELIYGKYIYMLIYWLASMSALLTAFYSMRLIYLVFITNTNIKKEIFIRKQKVSLYIIMALMGLVLGSIFNGF 469
170676861 481 LGKEVVISNVIPPMISNSVKVVPLVLSLFGALLG------FVIYDRVirvafweaaknrrgvinlvrvnsimnvrskfse 554
164421148 468 LGKEITLSNIIHPIVPGYIKTLPLILSLLGGIVA------FFLYSFN--------------------------------- 508
164421202 467 GGKEFFLSSEFVPVVPSLVKWLPLIFGLLGALGGgglskeYLFGYSKdslfnkqnkik--------------------il 526
164420985 468 GGKEVIISNVIHPIVPGYIKIFPLILSLLGGLLA------IFLYSSN--------------------------------- 508
126695324 470 ITREVVIGTVLPPVIPSSIKLIPIVLSLLGATLA------FLSYNTLng------------------------------- 512
164421187 471 LGKEYFLSNIITPIMPNSIKLVPLFFSLSGAGLA------YFLLCYQ--------------------------------- 511
164421142 471 IGSEVFLSGVVIPIIPNYIKLIPLFFSLLGGSLA------YLIYYIP--------------------------------- 511
124484820 468 IGKEFVLSNVMSPIVANGVKMIPLLFSLLGGSLA------LFLYVVV--------------------------------- 508
164421039 470 LTKEIILSNIIHPIIPNYIKILPVILSLSGGFCA------LLLYNRLwg------------------------------- 512
164421216 470 IMKEVLLSNMVTPFINTHTKMIPILFSIVGGVSA------FFIYNNF--------------------------------- 510
170676861 555 ervernfvsSSYNSRFYQRAWIMLYHIVYTFFNSAWQFNYVINHFIVSNVWKFGHLITYRIIDRGILEIIGPKGISKVLI 634
164421148 509 -------------ISWRMPTTRGIYLTFYTFLNSAWQFNYVINHFIIINVWRFGHKITYKIIDRGLLEQLGPNGISRVII 575
164421202 527 lnsdfnnksNFDLQIPSVSRSLCSFKFWYWFLNWAWRFKEVMTRNVLEKVLKFGYSL-FKWVDSGVLEYFGPRGIGAIMV 605
164420985 509 -------------VSWRMPMTRGVYLTFYTFFNSAWQFNYIINHFIVRNVWRFGHKITYKVIDRGLLEQLGPNGVSRVII 575
126695324 513 -------fkVFLPKIKPQTVVNLFNPAIYTFLNSAWQFNYIINHFLVAKAWKFGHLISYRVIDRGLLEIIGPRGISKLII 585
164421187 512 ------------INTLDNKVFKKTYHVIYTFLNSAWQFNYVINHLIIKQIWKMGHVITYKLIDRGILEVIGPKGLSVVFV 579
164421142 512 ------------IKIFRNKRWXRLFHIIYTFLNSAWQFNYIINHFVIKNIWKMGHLVTYKLLDRGLLEIMGPKGISIFII 579
124484820 509 ---------------APRGTIWLQGLPIYPFFNSAWQFNHVVNHYVIKNVFKFGHKVTYKVIDRGLLEIVGPEGVSKICI 573
164421039 513 -------yyVLIGAQGETFYNKGIYHSMYTFLNSAWQFNYIINHFIIVNVWKFGHLISYKVIDRGLLEILGPRGISSVII 585
164421216 511 -------------------IKYRLYHVLYTFINSAWQFNYLMNHFLTKSLWKFGYYISYKIVDRGVLEIIGPRGLIRVFT 571
170676861 635 NLTQAISNYQSGMVFNYALIMIIFTTL-FISGASIL 669
164421148 576 NLTQKMSNLQGGMVFNYALIMIFFTTL-FISGIL-- 608
164421202 606 VLGRVISRLQGGEYTVYILIMFWYVGLvYMTGSGIE 641
164420985 576 NLTQKMSNLQGGMVFNYALIMIFFTTL-FISGAL-- 608
126695324 586 GVSQKISXLQSGLVFNYALIMLVFTTL-FISGSGVG 620
164421187 580 KLTQIISKLQSGLLFNYVLVIIIFTTF-FISGFNIF 614
164421142 580 RLTQILSNLQSGLLFNYILIIIIFTTF-FISGLNVL 614
124484820 574 RLSQKISNLQSGLIFHYALTMISFVVG-FLYATA-- 606
164421039 586 NITQKISNLQSGMVFNYALIMIIFTTL-FISGVV-- 618
164421216 572 KLTKKLSKLQSGNLFNYAFIMIIFVLI-YLII---- 602
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap