Conserved Protein Domain Family
ND5

?
MTH00209: ND5 
NADH dehydrogenase subunit 5; Provisional
Statistics
?
PSSM-Id: 177252
View PSSM: MTH00209
Aligned: 9 rows
Threshold Bit Score: 568.893
Threshold Setting Gi: 219524192
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190349590   9 FFKKMMLMLLMFFILMMYYSIILFYN---KKIIIIEWEILMCQSLQIVMPLIIDWLSCMFLSVVMLISSAVMFFSDFYMK 85 
169794169   5 FKKIQVFWYKILYLFSFIMFVLFMFFsksSKTYILEFVLFDWNSISFSFPLIIDSISLSFSSVMLFISGSVMMFSNYYME 84 
169794155   1 ---MVIFWYKILYFFSFVMFTFFLWV---SDFYIFEFSLLELNSMSVSFPLVIDKISLSFSSIMLFISGSVVYFANYYMM 74 
8404660     1 --MTVFKSLSLVLVTSSLMLVPLGIScsyFSVVLLEWELFSVGPVSFFLPVLLDKMGIFFSLVVLLISGLVFWYSHSYMA 78 
15341655    1 MSINQIFSLYLGVVGGGLGLVGGVWGv--QEIVLLEWEVFYLGGMFLSFPIILDSVSLVFSGVVLMISGVVFWYSEFYMA 78 
126506290   1 -------MLFLLFFFGFLISLIFCNF---KFVYIFEIEFLEINSNSIIMTMIFDWMSVLFMTVIFFISGSVMKFSVEYMM 70 
219524192   9 TKAAIMMGMMLLLLLNAWNFIMFH-----NVSVMTEFSLINLGSINVPLAITIDKMSVLFSTIVITITMSVLLFSTSYMQ 83 
164420834   9 YPLMTAILLMTMFLITQMYNIYIIET---QTAVIKEWELLSIKSMMINVTLLLDKTSMIFSSTILLISFSVMLFTTSYMA 85 
299827796   1 -----MIILFLNFIFMFLISVKFMIN---NMIIIIEWEILNCNSMNLIMTMIIDWITCLFLTIVLLISSAVMFFSDFYME 72 
190349590  86 EENFKKRFCLIVILFVISMMFLIISPNMITILLGWDGLGLVSYVLVVYYQNNKSASAGMLTLLTNRVGDIAFL-LSIAWM 164
169794169  85 GEKFMNRFSILILLFILSMNFLIFVPNLITLLMGWDGLGIVSLLLVIFYQNSKSLGAGMITFMSNRVGDALLI-ISIGWM 163
169794155  75 GEKYMNRFIVLILLFILSMNFLIFVPNLITLLLGWDGLGIVSFLLVIYYQNSKSLSAGLITILSNRIGDSLLI-ISIGYM 153
8404660    79 GEVFPRRFGLITVLFVVSMNILIYVPNLVSLLLGWDGLGLISFCLVIYYQNKKSLASGMITALMNRVGDACLV-LVIAGF 157
15341655   79 GELYPSRFYLLTLMFVGSMSFLIFVPNVVSLLIGWDGLGLISFCLVIYYQNKKSLASGVITVLMNRVGDACLI-MVVVGV 157
126506290  71 EEKNKLRFCMIVIMFILSMIFLVISPNLISILLGWDGLGLVSYVLVIYYQNSKSNSAGMLTILSNRVGDVAFFnLYCIYI 150
219524192  84 KEKNIEYFTILMILFVLSMNILIFIPNLLFLLLGWDGLGLTSYLLVVFYNNSKSISAGMLTALTNRIGDALLI-IAVAWA 162
164420834  86 TDQNIKYFIMTVVTFIASMNALIFFPNLITILLGWDGLGLSSYLLVLYYMNEKAMNAAMLTALTNRIGDALLI-MAVAWT 164
299827796  73 DEKFKSRFVMLILLFILSMMLLIISPNLITILLGWDGLGLVSYILVIYYQNTKSSAAGMLTVLTNRIGDVAFL-LCIGWM 151
190349590 165 LNHGNWNFLTLNyyYNYSMMYwICLFMLLAAMTKSAQLPFSAWLPAAMSAPTPVSALVHSSTLVTAGIFLMIRLSYYFTN 244
169794169 164 ISMGSWNIYFTN--FSSGFGF-VLWCVVIAAMTKSAQIPFSAWLPAAMAAPTPVSALVHSSTLVTVGIYLLVRFYDQIFI 240
169794155 154 TMVNNWNIFYLE--SMSGFMIvVLWCIVIAAMTKSAQIPFSAWLPAAMAAPTPVSALVHSSTLVTAGVYMLIRFFDQLGE 231
8404660   158 LCFGHWSILYRE-----MIGVvLGVLVVVAASTKSAQIPFSSWLPAAMAAPTPISALVHSSTLVTAGVYLGIRFHGMLFS 232
15341655  158 SCFGDWSLFYQK-----DLGIvLSVLIVVGGLTKSAQIPFSAWLPAAMSAPTPISALVHSSTLVTAGVYLIIRFYSSVFS 232
126506290 151 NYHGNWNFFSLSv-FDKNIISvMVVLMLLAGITKSAQIPFSAWLPAAMAAPTPVSALVHSSTLVTAGVFLMIRFSEFFSS 229
219524192 163 LMLGHWNMSFSS----FNLNMlISMMIILAAMTKSAQMPFSAWLPAAMAAPTPVSALVHSSTLVTAGVYLIIRFFPTLSE 238
164420834 165 MMKGNWNMFLLT----LQSPSfIMMSIMLAAMTKSAQLPFSAWLPAAMAAPTPVSALVHSSTLVTAGIYLLIRFFPSFNM 240
299827796 152 LNHGNWNFFSLNnnLNEEMKLwVCFFMLLAAMTKSAQIPFSAWLPAAMAAPTPVSALVHSSTLVTAGVFLLIRLNNYLSS 231
190349590 245 MPMFQMILLFASSLTMLMASMVANNDYDIKKIIALSTLSQLGLMMAIISLNYVNLAFFHLIVHAMFKAMLFICAGIMIYK 324
169794169 241 IPSLSWYILNIGTLTTLMAGMSAVSETDLKKIIALSTLSQLGVMMFSLGLGLKELCIFHLYTHALFKALLFICAGGMIHS 320
169794155 232 TLMW--YILHIGVLTTLMAGMSAIFESDLKKVIALSTLSQLGVMMFSIGLGMKELCIFHLFTHALFKALLFMCAGSMIHS 309
8404660   233 SSFVWGVVLLLGVSTTLMASSVALVESDLKKVVALSTLSQLGLMFCSLVLMSPEICLFHLVMHSLFKALLFLGVGNVIHS 312
15341655  233 SDFVGSGVLLVGFTTSVMASLSAVLESDLKKVVALSTLSQLGLMFCAMSFVGPVVCLFHLVMHSLFKSLLFLSMGNIIHM 312
126506290 230 MMFFKVSLLFMSSLTMMMASVVANFEFDIKKNIALSTLSQLGLMMSIVALGFPNLAFFHLLTHAVFKALLFICSGSIIHN 309
219524192 239 FYMLKFMCFYLGTMTCMMASMAAMVENDLKKIIALSTLSQLGIMMIALGIEQPILAFFHLITHALFKALLFICAGDIIHS 318
164420834 241 LKNFSMLMMITGIMTCLMASMSACMENDLKKMIALSTLSQLGVMMMCLGANQPQLAFFHLITHALFKALLFICAGNIIHS 320
299827796 232 YILFNVSLMLFSSMTMLMASIVANYDYDVKKIIALSTLSQLGLMMSIISLNMTNMAFFHLITHALFKALLFICAGIMIHK 311
190349590 325 FMHFQDIRMMGYLTMHMPIISICLNTSNLALCGIPFMAGFYSKDLILEQFLFCKMNFMCMIMLFVATGMTVMYSLRMSYF 404
169794169 321 HSHLQDVRKLGSVWYFMPITTSCLNIANLSLCGFPFLSGFYSKDLILESMLENQITSVTLSLMVVATFLTTLYSARLTFL 400
169794155 310 HHHSQDIRKVGMMWYYMPISSCSLNIANLSLCGFPFLSGFYSKDLILESMLENKITILTLILMVLGTLLTTLYSVRLTFF 389
8404660   313 HGGSQDLRSVGMLWSQFPVTVASMNVSFLAMSGTPFLAAFYSKDMIIQSSVVSGFPILVLVLFLISLNLTASYCIRMAYY 392
15341655  313 VGGSQDLRSVGGLYKQLPLTVSCMNVSFLAMSGVPFLAAFYSKDMIVHCAFEGVYGGMILFMFFFSLALTVPYCLRLSYY 392
126506290 310 FGHVQDIRMLGLVTNQMPKVSICLNIANLSLCGIPFLAGFYSKDIILEMYCYSNWNFISFIMLFIATSMTASYSIRMAYF 389
219524192 319 EMNNQDIRLMGNLSETSPVNSMMLNTANLSLCGLPFMAGFYSKDSIVETFFMTSMPMSTSLLMMASICLTAAYTMRVSIL 398
164420834 321 NFNNQDMRMIGNMSQSMPLTTATLNIANMSLCGLPFMAGFYSKDLIIETLMHTNVPLMTMMLMLLSVSLTSAYSMKLAML 400
299827796 312 FLHFQDIRMMGYMTFHLPIISICMNSANLALCGIPFMAGFYSKDMILEMMVSSNMNMISLIMLLLATGMTVMYTFRLMYF 391
190349590 405 SFWGTNSIKSINLVPLNFKMN-KGALILTFGSIMSGSILSWLTMNPTLNVFMPLKLKMMIIMLIMIGILLGNLLYKLNFL 483
169794169 401 SVIKNNNFFPMSSKLEENDFNvKPMVLMTLVSIMSGPSLYWVMNSEVLEPNMNVFEKLLPLILILSAIVVVFSGSKHLFM 480
169794155 390 SLIKINNFMPLSSSLEENSNNiNPIQMMTLVSIISGPSLYWMMNYEVNEPWLGTVEKFLPFALFLFGVLLMYISQQNFF- 468
8404660   393 MLWGVSSQGGLSCLSDQDKIMgVPMLVLSIGSVLGGAVMSRVLVPSYEVVVLSWELFLVPILSIGGGVLLSGFVLVYG-- 470
15341655  393 LVCGSLGSPSVLCYGDSDKDGlFPMIVLVLGSLVGGSVFSRVLVPN-FSVVCNWGGFLAPVVSLFMGVYLAGVLLK---F 468
126506290 390 SLWKKIHSKSMNSIFEGESEIsSSAMLMSMGAVVGGSVFSWLIFSSPNSIELFVLLKVSTLIVTFAGGMYMLSVKEKNYF 469
219524192 399 TLWSPM--KNLNFSQSKSKFTyLSYLILLMGAITGGALMDKIMLIS-NPPSLPMFLKLLTLMLIIAIATYSYINMN---- 471
164420834 401 TLWSPVKGSAMQNPNDQSKLSlISYVTLTTGAITSGASMNWFFSPQLMDLTLPIYLKLMTITIITFMGMMMWMVMK---- 476
299827796 392 SFWNKMSMKSLNLSFYTNKLN-NGALVLISGSVFGGSTIGWLSMDSSMVIYLPTHIKLITSLLILVGIWIGYMLSNKTLY 470
190349590 484 KnkmYIYYKFKFYNSQMWFFPENSSQSFLMNTMMLSKKSFI-LDNNWVESMSAQGSYKFIMSFSKFNEICQENSMKLFMM 562
169794169 481 A---KNKMMLFYSCSNMWFIAPLSSQPVIMSFMKVSQDNIKlVDQGWNETLGGQGLFKISSSIFRFMSIIQMSKVNVFVG 557
169794155 469 ----LKKMKVTYMSSSMWFIAPLSSQPLVKSFFYFSENNIKlIDQGWNEIIGGQGIFKMSNFIFTNFTKIQYNKINIFVV 544
8404660   471 ----IRGYSVNFLLMQMWFLKDLS-LPVVGYGLGSSGSMTKvLDQGWNEYTTAKSSGYILGPVFGYSWNFQESTLKPLVF 545
15341655  469 PggvGGGGKSESFWGGLWFLGDLASKPVSVVVMSVSGTMLKsCDQGWVEHMTSKSFERVFYTASGLMLTSQVSSLKSSVL 548
126506290 470 LgekMKF--IFYFFSQMWFFPKISSQIFLNFMMSWSKFSFEnVDISWVEMLGLQGTFKVLVYSSKILQSIQKNSIKTYLF 547
219524192 472 ----IFYKKMNVFMTSMWFMTYLSASPINNLTLKLSKQMLY-IEATWMEKLSGKGSFNTLSKMSKSTQKINQLNLSEMMT 546
164420834 477 ----YHQIPQNHFLTTMWFLTFITTFHINKKSSKLMKTMQY-NENTWMEKISGMGMKSLMKKNTQLSQSSTNMSWTMTMT 551
299827796 471 Ll-kFKNYKMKSYNSSMWFYPEISGQSLIYFTMKYSANSYK-ADTNWMEMMSSLSMFNMLKVSSEMNEILQNNSLKLYLS 548
190349590 563 VTMIPMTMIMFLM 575
169794169 558 LMVLNLLIVIKVW 570
169794155 545 LFFLNIIMMMLFM 557
8404660   546 FSGWVLAGVVLWV 558
15341655  549 FLGGCVLGVLVFG 561
126506290 548 SMIIIMFVCWMF- 559
219524192 547 YFSMLLLFIILIK 559
164420834 552 SMMLIMMITIMNL 564
299827796 549 IIMFPLGFYLIYF 561
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap