Conserved Protein Domain Family
ND5

?
MTH00208: ND5 
NADH dehydrogenase subunit 5; Provisional
Statistics
?
PSSM-Id: 177251
View PSSM: MTH00208
Aligned: 29 rows
Threshold Bit Score: 672.452
Threshold Setting Gi: 289183215
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
289183246   3 INPLLIILSINASIiITLIVSIFFFSssfstsiepsTRSNTSEVVGVTTVIQSDKITHSLSPGPFMINVLKILAFLSIVS 82 
5835468     1 MNVYFLLTSISTFVfFLLIMSISSSA----------HSLNSSNFLFSVFGLILNNNKIFYDFGQLSISSLKLISFFSLIN 70 
49147341    1 ----MILNLIIMISfLLFITNNFFNA----------------------------------STKSNSTNLLMNSSIVSALV 42 
41057403    1 ----MLMYFSILITfSSYLTLSFFSP--------------------------------NNNSSAKNISLLGSTVCLAGAL 44 
84488829    1 MNLYFLLISIGLFIfIILIMSVFSLS----------NVLSPVFFVGRFFGLFFNNSIVFYNYGSLSIVSLKFLSVFSLFS 70 
188039023   1 ----MILSLIILTSfSFFLILNFYNK----------------------------------NNNFSPVNLLMNSSIVSGII 42 
188039037   1 MNLIFFLISSGIFVfFVLIINVFSSS----------LSFNSNNSFFRIFGFSFSLNKISYDFSYLSVSSLKLLSLVSLLS 70 
289183188   1 ----MIIAISIFMSfLIFLTFSFFIP--------------------------------NNSKSNITISLLKISAGGGVIA 44 
289183215   1 -------MILSITIlLSFLLFFFLNN-------------------------------------NNNNSLLGGGALINFNF 36 
289183159   1 ----MILSLLTLSSlILFLIFSFFNP--------------------------------NNNKSNITILLLLTSAFMSGCL 44 
289183246  83 LAISLYSEFQNINITFSFWLNNTPTNVSLNLMYDQYFVVFLTVALIVTWSIIEFSHYYMASDPNSTAFFRLLTIFLLNML 162
5835468    71 FYLYLSLGCPNINIILFNWLSNEGFLGSFSFCFDFFSLCFFFVGGYVTWSIVQFSYYYMGDDPRWFSFFRLLLIFLLNML 150
49147341   43 LVYWIINGVPLFIINVN-WLNWGLQSFSLSLVIDFPFVAFSTAALFVTWSIIEFSEYYMSNDPNKNAFISTLILFLLFML 121
41057403   45 LIGWLLSSCPVTTASLS-WFSSYLGSFHCSFIFDFLSTLFFSVALAVTWSIIEFSHYYMATDPNASRFIRTLILFLFFML 123
84488829   71 FYFYLSFGCPNIYIVLFNWLENYGFLGNFSFVFDFYSVVFFLVASYVTWSIVEFSYYYMSSDPRWFSFFRLLMVFLLNML 150
188039023  43 LAIWFLNGLPSFIINLN-WLTWGLQNFSLSVFIDFPLVIFSAVGLFVTWSIIEFSQYYMDNDPNKSAFINTLILFLLFML 121
188039037  71 LYFYLGLGCPNILVTLFNWTGDYGFLGNVSFCFDFFTFCFFFVGVCVSWSIFQFSYYYMSDDSDISSFFRFLLIFLLNML 150
289183188  45 GGYWTSLDCPSFIFSSY-WFFPYLQNFSLSFVIDYYFIIFGSVALLVTWSIIEFSHYYMVSDPHKQAFFNTLILFLFFML 123
289183215  37 SIIWFLLDCPIFIINLK-WNFSSLQEFNLSFIIDTPFILFSSVALFVTWSIIEFSHYYINNDHNKNSFINALIFFLSFML 115
289183159  45 LLGWLLANCPVTYFSLS-WLSAGLTTFSLSFIVDRAFIIFLAVALFVTWSIIEFSHYYMEADPNKQSFLNTLIFFLLFML 123
289183246 163 ILTCSNSLFLIFLGWEGVGFLSFLLISWWTTRNDANSAALEAVIYNRIGDIGLITFMALSILLTNSWNLNEV-ILN-SQQ 240
5835468   151 LLVSSNNLFFIFVGWEGVGFLSFLLISWWNTRVVANSSALEAVIYNRIGDVGFLILLGICFVYFNTWSLLEV-YGLlNNA 229
49147341  122 ILVSSNNLFLLFVGWEGVGIMSFVLIGWWFTRSDANSSALQAILYNRIGDSGMILFMVIALLNFNSWNLSNI-IFF--NN 198
41057403  124 LLVASNNLFLLFVGWEGVGILSFILIGWWFTRSDANSAALQAIIYNRIGDSGIIILLSLTIINNNSWNLQEI-LYI--NH 200
84488829  151 LLVSSNNLFFVFVGWEGVGFLSFLLISWWNTRNDANSSALEAVIYNRVGDVGFLVLLSLCFIYFNTWSLLDIsFFLlNNI 230
188039023 122 ILVSSNNLFMLFIGWEGVGIMSFILIGWWFTRSDANSSALQAIIYNRIGDSGMVLFMVIAMLNFNSWNLNEI-IFF--SS 198
188039037 151 LLVCSENLFFIFVGWEGVGFLSFMLISWWNTRSDANSAALEAIIYNRIGDVGFLVFLSFCFVYFNTWSLFEF-SFLlNNS 229
289183188 124 LLVASNSLFLLFIGWEGVGILSFILIGWWFTRSDANSAALQAIIYNRIGDSGMILFLLLCILQNNTWNLNEI-IYF--SS 200
289183215 116 LLVSSNNLFLLFIGWEGVGIMSFVLIGWWFTRPDANSSALQAIIYNRIGDSGMILFMVISIINVNSWNLNEI-FFI---- 190
289183159 124 VLVSSNNLFLLFIGWEGVGFCLLFLLDGGLLEQMLNEPALQAVIYNRIGDSGMLLFLLSSIITYNTWNLNEI-ILL--SP 200
289183246 241 FTSFVPFMLFGLVLAAAGKSAQFGLHPWLPAAMEGPTPVSALLHSSTMVVAGVFLLIRTESLLAINTSAQSAVLILGGIT 320
5835468   230 NSLIINGILFSGLLASIAKSAQVGFHPWLPAAMEGPTPVSALLHSSTMVVAGVFFLIRLGSLLNFPSFFCSFCLFIGGVT 309
49147341  199 ESAPINIAIIGIILAAVGKSAQFSLHPWLPAAMEGPTPVSALLHSSTMVVAGVFLLFRCSPLFENSLWALITISLLGSVT 278
41057403  201 PTGVSSLCVLGIIIAAAGKSAQFVLHPWLPSAMEGPTPVSALLHSSTMVVASIFLLIRTTPLIENHTWGLSLIGLIGALT 280
84488829  231 DFWLVHSFLFSVLLASMAKSAQIGFHPWLPAAMEGPTPVSALLHSSTMVVAGVFFLIRIGTLIDFSGFFCSCCLFVGGVT 310
188039023 199 NSTPIYIAILGIILAAAGKSAQFSLHPWLPAAMEGPTPVSALLHSSTMVVAGVFLLFRCSSIINHFPWALALISILGAIT 278
188039037 230 SSFLINCMLFSGFLASIAKSAQIGFHPWLPAAMEGPTPVSALLHSSTMVVAGVFFLIRLSSLINFTPFFSSVCLFIGGIT 309
289183188 201 SNPLSQWGLLGIIIAAIGKSAQFSLHPWLPSAMEGPTPVSALLHSSTMVVAGVFLLVRCTPILENSLWALPTISIIGALT 280
289183215 191 NNSISFLAIIGIILAAMGKSAQFSLHPWLPSAMEGPTPVSALLHSSTMVVAGVFLLFRCSPLLNDFNWAPALISIIGSLT 270
289183159 201 ISPQTVWGLIGIIVAAAGKSAQFILHPWLPSAMEGPTPVSALLHSSTMVVAGVFFLYRCSPILPLITWIPPLIGVLGSLT 280
289183246 321 ALFAASTAVVQHDIKKIIAYSTTSQLGLMITSIGLGQPLLALFHICTHAFFKAMLFLCSGSVIHSLKDEQDLRKMGGLSS 400
5835468   310 SLFAASAALVQHDIKKIIAYSTTSQLGLMVVSIGLGSYIIAFFHICTHAFFKAMLFLCSGSIIHSLNNEQDIRKMGGLFF 389
49147341  279 ALFAASVALSQYDIKKIVAYSTTSQLGLMVVAIGIGAPNLALFHICTHAFFKALLFLCSGSVIHNLNNEQDIRKMGNASN 358
41057403  281 ALFAGSAALSQYDFKKIVAYSTTSQLGLMAVAVGLNLPYLAFFHICTHAFFKALLFLCSGSMIHSFNNEQDIRKMGNASN 360
84488829  311 SLFAASAALVQHDIKKIIAYSTTSQLGLMVVSVGLGNCIISFFHVCTHAFFKAMLFLCSGSVIHSLNNEQDLRKMGGLFN 390
188039023 279 ALFTASIALTQYDIKKIVAYSTTSQLGLMVVAIGINIPELALFHICTHAFFKALLFLCSGSIIHNFNNEQDIRKMGNSSS 358
188039037 310 SFFAASVALVQYDIKKIVAYSTTSQLGLMVVSIGLGSHLIAFFHICTHAFFKAMLFLCSGSIIHSLNNEQDIRKMGGLFT 389
289183188 281 ALFAASAALSQYDIKKIVAYSTTSQLGLMVVSIGLNLPWLALFHICTHAFFKALLFLCSGSIIHSLNNEQDLRKMGSSGL 360
289183215 271 ALFAATAALSQFDIKKVIAYSTTSQLGLMTVAIGLNIPNLALFHICTHAFFKSLLFLCSGNIIHNLNNEQDLRKMGNTAT 350
289183159 281 ALFAASAAIAQYDLKKVVAYSTTSQLGLMVVAIGINIPELALFHICTHAFFKSLLFLSSGSIIHSLNNEQDLRKMSNSLT 360
289183246 401 LLPVTSACLILGSLALMGTPFLAGFYSKDLILEAAGASTLNSLGLALSLIATLLTAVYSFRIILLCFLSSPTISPLSPIE 480
5835468   390 LLPVTSSCILLGSLALVGTPFLAGFYSKDLILELGLISFSNFFGIFLAFLSSIFTVIYSFRIIIYCFLYPMTGNSILPIS 469
49147341  359 SLPLTTSCIIIGSLALCGLPFLAGYYSKDVILEASQNSITNSISVILAFLATLMTAIYSMRMIFFVSFPNINSAPINPVS 438
41057403  361 SAPYTTSAIILASLALSGLPFLAGYYSKDLILEAGQISNTNSNSVILALIATIMTAVYSLRLIYFITNPQPNNSPIVPVN 440
84488829  391 FLPITSSCIFLGSLALIGTPFLSGFYSKDLILELSFLSFSNFLGVFFAFLSSLFTVIYSFRIIFFCFLYPMLGSSLCNIN 470
188039023 359 SLPITTSCIIIGSLALCGLPYLAGYYSKDLILEASQYNISNGVSVLLAMIATLMTAIYSLRLIYFIAFTKTNTSPINPIS 438
188039037 390 LLPLTGSCILLGSLALVGTPFLAGFYSKDLILELGVVSFSNFIGIFIAFLSSIFTVIYSFRIIVYCFLLPTTSGSLLIVS 469
289183188 361 ILPVTSSTLTVASLALCGVPFLAGYYSKDLILEAGQYSISNNISIILALIATLMTAAYSSRIVYFLAFNKNTSDPASPIS 440
289183215 351 FLPLTTNCLIIGSLALSGIPFLAGFYSKDLILEASQNNITNSISLILSLIATFMTAFYSGRIIYFTSLNPTNIPTTSSFN 430
289183159 361 FLPFTTSCIVIGSVALCGFPFLAGYYSKDLILEAGQANIVNSLSIILSLIATLMTALYSARVVLY-LGTNTNTPPLNPIS 439
289183246 481 EENQNLNGALLRLSIGTIISGWFFSNFIFNAPMLVVPSTIKSLPLIVTIAGTGMLIVLLGYLTEKAINSKAHST----LT 556
5835468   470 EENLNLTSSIFRLGLGTILSGWFFCSYVFPSVIFVLPFYLKIIALLLIFFGILFSLSFNLGLNSFLSSFYYYWF----LS 545
49147341  439 EENNNLANPITRLAGGVFFSGWIISLCFINNETFVIPWANKILPLVMLICVTAYTFN---SLNMNIISNDVFQSlsniSS 515
41057403  441 EENNNLLNAISRLLLGTMIVGWGLSVSLLIFPPCFFP---SGNDIPLAILSIAFIILILNATNLTPKTTVQF------LA 511
84488829  471 EESFNLVFSIFRLGVGTIFCGWFFCGYVFPSVVFILPFSLKSLSLFLIFFGMLFSFCFYLSYNGFFTYFFLYWF----LS 546
188039023 439 EENPNLTNPLIRLASGVFLSGWIISVCLINNETMNIPLLNKITPLIMLLYASVSILNNLFNNINLHSQSTIn-----fLS 513
188039037 470 EENPNLIFSIFRLGLGTIVIGWFFCSYVFPAVVFILPFYLKIAALLIVFLGIILGAGFYIGFISFISSFFYYWF----LS 545
289183188 441 EENKNLTFPLLRLLIGVFIVGWSFAFTTFHSSSLTIPLINKSIPLIISILAAFYLFFFSNSFSINLLNLSHF------LS 514
289183215 431 EENLNSTLPLIRLISGVILSGWLFSLFFFEVNPLVLPLINKIIPLLLTIYALIL---IINNLSLHPFNTNNLLNiwnfLS 507
289183159 440 EENNNLYYPLVRLIFGVFVSGWLIYLSIINLPPIIVPLLNKSLPIIVTLYSVIFIFERLT---PNPINTNICLGaikfLS 516
289183246 557 LQWFFVDLIHTASITTSFVLSLFFSTRTMDRGWSENIGPQGTGALSLLAAKTNQSLQSGLIKRYAASSILLIFTISLVSL 636
5835468   546 YQWFYLFFFHSFVSSFYFYISLIAGSRLLDRGWFENVGPQGSGYLVSSGSSSSQYFYSGYIKYYILFSFLSGFIFFTLLI 625
49147341  516 NGWFFVNLIHGNSILTLISWSISGVLRSLDQGWTSFIGAISISNTVVFLANLILNAHKSLISSYFKFLLLITVAALLVLL 595
41057403  512 TNWFYVQIIHTITNNITLINSLKGVLRTLDQGWTMSL-PHSTVNGISKLLSYLQQSMSGNITNYIGASTTLATTIFIILA 590
84488829  547 FQWFFLVFFHYFFSFFYFFLSLYGGSRLLDRGWYENLGPQGSGYLITYSSSSSQYFYGGYIKYYLFFSFLTSVFIFTLLV 626
188039023 514 NNWFYVNIFHSNSIIKTLKLSIEGVLRTLDQGWTSFLGATTINKTTIFLSNYLLNIHNSLIPSYFKFLISLIFIVIIFIL 593
188039037 546 FQWFFLFFYHSFSISLYSFYSLIVGSRLLDHGLGENIGPQGSGKFIYSISSS--LINNSNIKYYIFFSLLSCILIFTLLV 623
289183188 515 NNWFFVHLFHSNILFASLNISIQGVLRSLDQGWATLTGPGGAINPILYSAKILQKSQNGNLLSYTFYFILLVFILLIFLI 594
289183215 508 NNWFFVNIFHQNTFSFSINTSINGINRTLDNGWNIFFLSNWLSNNIILSSNLIQSTHSAIITNYLTFFFILTTLLILSSL 587
289183159 517 NNWFYVQVVHGNTLSGVITTSVKGVLRSIDQGWAASIGGLGITHFTRYLVTHLQFSQQANIITYLTYSTLIFLMLGILCL 596
289183246 637 LI 638
5835468   626 FF 627
49147341  596 IT 597
41057403  591 LF 592
84488829  627 FF 628
188039023 594 VN 595
188039037 624 FF 625
289183188 595 AS 596
289183215 588 YT 589
289183159     --    
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap