Conserved Protein Domain Family
ND5

?
MTH00207: ND5 
NADH dehydrogenase subunit 5; Provisional
Statistics
?
PSSM-Id: 164753
View PSSM: MTH00207
Aligned: 8 rows
Threshold Bit Score: 766.62
Threshold Setting Gi: 238866917
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
172088180   1 MSFFPSSLNASRLLTSFFIFMFPLSLWSNFMNKTLIIEWEIMTIQSSHINFMIILDPMGTLFSSTVLFISANVMYFSSSY 80 
150375686   2 LRQFKIHKQASALMWVMLAMMVPLTIYLTMLNKTILIEWTLFTISSTPMTFTLIADPTGTLFSATALLISANVLQFSTIY 81 
192288385   5 KMPQSPAILYSYLMFTLSFLIFPISLFLMFKNQSIFIQWEMFYIFSSPIFFPILFDPYGMLFSSVVLFISANVLKFAETY 84 
192288413   2 IFHLKSSFIASITLFFSSLLMFSFATYLNHISMTWPISWEICSINSSIINFPIIFDPMGTLFASTVLLISANVMLFASTY 81 
91176256    1 ----MTPSIATYLLWSLWLIATPLAL---TCTSTILLEWSLVQISTSPIYLPLIIDQTGMLFCSAVLFISANVMNFAKSY 73 
5835199     2 LRMFNTSLVASKLMWVIFTGMLAPTLYMVHCNSTLLLEWNLFSISSTPMMMTIILDPLGLMFSCTVVMISANILKFSTIY 81 
54310667    1 --MTQPFSRSAFSLIFMAIPTLILSSSLMMNNYSILIEWEISNINSTPLLLTMVMDPVGTLTSAAVMFIAGNVLLFAKTY 78 
238866917   1 --MTQPFSRSAFSLIFMAIPTLILSSSLMMNNYSILIEWQISDINSTPLLFTMVLDPVGTLTSAAVMFIAGNVLLFAKTY 78 
172088180  81 MADELFLKRFIHLVLLFVASMNLLIFIPHMMILLLGWDGLGLVSFLLVIYYQNAKSLAAGMITALMNRVGDVMILLSIGW 160
150375686  82 MKDDKFIDRFSSLSATICIINKSINFLPHLMMLLLGWDGLGLVSFILVIYYQNPKSLAAGMITALTNRIGDVMLLLSIAW 161
192288385  85 MSGDPFLNRFIALIVLFILSMNMLIYFPHMMTLLLGWDGLGLVSFILVIYYSNPKSLSAGMITALTNRIGDAFILISIGW 164
192288413  82 MAEEIFLTRFIILVLLFVLSMNMLIFFPHLMTLLLGWDGLGLTSFILVIYYQNAKSLGAGMITALTNRIGDVTLLVAIGW 161
91176256   74 MQDDKALSRFTYLVLLFVLSMNLLIFIPHLIALLIGWDGLGLVSFLLVIYYQNPKSLGAGMITVLSNRIGDAFLLLSIGW 153
5835199    82 MKEDKFINRFTVLVLLFVLSMNMLIFFPHLIILLLGWDGLGIVSFILVIYYQNPKSLAAGMITALTNRIGDVMLLLAIAW 161
54310667   79 MQEETFKSRFNNLVLLFVLSMNMLIYLPHLIILLLGWDGLGIISFLLVIYYQSPKALGTGMITALTNRIGDAMLLVAIAL 158
238866917  79 MQEETFKSRFNTLVLLFVLSMNMLIYLPHLIMLLLGWDGLGIISFLLVIYYQSPKALGAGMITALTNRIGDAMLLVAIAL 158
172088180 161 TLNQAHWSIMNMWANNFSP-VITLCIMIAAMTKSAQTPFSSWLPAAMAAPTPVSALVHSSTLVTAGVFLMIRFYPFLHKT 239
150375686 162 TLNQGHWSITHMWHTDLYN-WQVAAITLAAMTKSAQMPFSSWLPAAMAAPTPVSALVHSSTLVTAGVFLLIRFYPFLTTT 240
192288385 165 SLNNSHWIITNMWQSNMSN-FIILSILIAAMTKSAQMPFSSWLPAAMAAPTPVSALVHSSTLVTAGVFLLIRFYPFLSSL 243
192288413 162 TLNNNHWSIMNMWFNPMSN-LIILCITIAAMTKSAQMPFSSWLPAAMAAPTPVSALVHSSTLVTAGVFLIIRFYDFLSSF 240
91176256  154 SLNQGHWTIISMWDTHMNS-LLSMAIMIAAMTKSAQLPFSSWLPAAMAAPTPVSALVHSSTLVTAGVFLLIRFAPFLNKT 232
5835199   162 TLNQGHWNILHMWAVDENM-YQALVIIIAAMTKSAQMPFSSWLPAAMAAPTPVSALVHSSTLVTAGVFLLIRFYNFLSSV 240
54310667  159 TLSQAHWNIFNFTQEFINSpYVALSIMIAAMTKSAQVPFSSWLPAAMAAPTPVSALVHSSTLVTAGVFLLIRFYPFLSSF 238
238866917 159 TLSQAHWNIFNFTQEFLNSpYVALSIMIAAMTKSAQVPFSSWLPAAMAAPTPVSALVHSSTLVTAGVFLLIRFYPFLSSF 238
172088180 240 VWFNNAILLIATTTMLMAGMSALAECDMKKIIALSTLSQLGVMMMSLGLNFPHLAFFHLITHALFKALLFLCAGSMIHLH 319
150375686 241 TWFNKTLLLIAVLTTTMAGLSAMTECDMKKIIALSTLSQLGMMMTAMGLGMVNLAYFHMVTHALFKALLFICAGTLINSH 320
192288385 244 KLFNTLLLITASMTMLMAGLSALTESDFKKIIALSTLSQLGVMMASLAMGFPTLTLFHLLTHAMFKALLFVCAGSMIHFH 323
192288413 241 YLFTPILLLTASFTMFMAGLSAMTECDLKKIIALSTLSQLGVMMASLALGYPKLAFFHLITHALFKALLFICAGSIIHFH 320
91176256  233 SWFCPTLLLIASMTMLMAGYSAMGECDMKKIIALSTLSQLGVMMASLGMGNQKLALFHLLTHAMFKALLFICAGTIIHTH 312
5835199   241 WWFTTFLLFVAVSTTLMAGLSASSECDMKKIIALSTLSQLGMMMAAMGLGMAHMAFFHMVTHAMFKALLFVCAGSFIHSH 320
54310667  239 YWFAPALLFTSTLTMLMAGLSAILECDLKKIIALSTLSQLGVMMAALGLNQPKFALFHLITHALFKALLFVCAGTLIHYH 318
238866917 239 YWFAPALLFTSTLTMLMAGLSAILECDLKKIIALSTLSQLGVMMAALGLNQPKFALFHLITHALFKALLFVCAGTLIHYH 318
172088180 320 HHSQDLRFMGNLSSQMPLTTTCLLTANLALCGSPFLAGFYSKDMIIESTLFFNNNILIISMLILATALTAAYSIRMMLTV 399
150375686 321 YHSQDLRWMGNITAQMPTTTSCFILANMALCGAPFMSGFYSKDMIIESSVFYHNNYIMLLIIMFTVSLTSFYTTRFSLAT 400
192288385 324 LHDQDLRKINNMSIQTPLTMACFLIANLSLCGSPFLAGFYSKDFILEISLFSPMNSMALLMFYIATGVTAAYTVRFLMYS 403
192288413 321 QHGQDLRTIGNLTNQLPFTMSCMLIANMSLCAAPFLSGFYSKDLILELSLFNPLNYTISLMFFCATTFTAAYSVRMTLTA 400
91176256  313 HHTQDLRHMGNTWNQMPLTTSCLMIANLALCGSPFLSGFYSKDLIIESALFYPHNSLIILMFIVATALTTAYSIRFMLSV 392
5835199   321 MHSQDLRWMGNLTKQMPTTTSCLIMANLALCGFPFMSGFYSKDMIVEASLYYPHNSLMINLILFAVGLTAFYSTRFTMCV 400
54310667  319 HHTQDLRTMGNLPNQLPITMSTMFLANLALCGFPFLAGFYSKDLILESALFFNHSLLMILLIFLATMLTAVYSMRMTMAS 398
238866917 319 HHTQDLRTMGNLPSQLPITMSTMFLANLALCGFPFLAGFYSKDLILEAALFFNHNLLMIILIFLATMLTAVYSMRMTMAS 398
172088180 400 VWGPLSSLPYQYTSDEDySLTTPMINLTAGAICSGAALNWFMFQPMMEPVLPFTLKVSALLVTIMGAWLAWMT-TSYTTS 478
150375686 401 IWSPSSSAPFSHLEENN-SLTTPMLVLALMSVTSGAAMLWTMPTNQEPMTITLDYKTYATINNHSSHFNSMSF-TTFYIK 478
192288385 404 MWSAPSSPPIHNIFDKDpNIFVPALLLTMGAIFSGSSINWWLAPIDQESFLPLQYKLLPLLVTIIGALLSMLF----FSS 479
192288413 401 IWSNNLASPNHFLSNHDmNMVLPITSLTLGAILAGASINWWISPMNLEPILPMHLKFLPISAMLLGIFFAWQT-IVSFST 479
91176256  393 LWSPVQNQPMLYTHDTDlNCSIPMVLLTLKAITLGCILNWSLISPISHPTLPIMWKLMPILVGLLATFLVWMT-QAPNIT 471
5835199   401 VLSPNNCGPYMHLEESN-SLTSPMLLLASMSVISGSALTWILPLKQEMMMIPLDQKLKTLMLVTLGALMSWFFlTTTNMT 479
54310667  399 LVSPAYSSPLISLENETkSLTTPALNLCLAAIVGGSLLNWMLMTPLTPFILSSQYKMLTPLVVTLGLLIAYLIgMKPNFN 478
238866917 399 LVSPSYSSPLISLENETkSLTTPALNLCMAAIVGGSVLNWMLMTPLTPFILSSQYKMLTPIVVTLGLLIAYLIgMNPSFN 478
172088180 479 TPALSLSYTSPHHFNAFMWFLVPTTAQGILSLPMHFAHKLLSTLDQGWVEFLGAQGTFKTFSRSSALKEKWLGAVTTTHL 558
150375686 479 NTPLMMNNPLTHYASCLMWFLVPLSSQFTMKTPMNISHNYLKSLDQSWLETFGGQGTAKMTYTASNSVMNLSNIGPVNYL 558
192288385 480 FSPTLINMNLSHNASCSMWFLVPLSSQAPMSSFLPLAHNFQKLLDHGWVEMMGGQGIFTLFSKYYLNPLKVQKSSPNIFI 559
192288413 480 NLSFWQNNKMSHNASCLMWFMTPISTQSLISTPYLLALHFQKTLDNGWTEMSSAEGTFFSSFSISNLFIPIQKNQINSFA 559
91176256  472 SEAKMISTQTIHFNMTSMWQMVPISTQSISTPFYALSNTSTKLNDHGWFELLGPQGTYKMITRTGSHIQSLQALPLTSFI 551
5835199   480 KTCLYIRHPIINYFSCTMWFLVPLSSQFMMKLPMYVSHNYLKLTDQSWLELLGGQGINNVSSKASNIYLASLKSTPMNYL 559
54310667  479 KNITLTPSKEATFN---MWYLTPLSSQFVMSKPMKLGSLVLAQMDQGWLES-PAQGASQTLSLSGSNVMTLQNNIMNKYL 554
238866917 479 KNITLTPSEEATFN---MWYLAPLSSQFIMSKPMELGSLVLTQMDQGWLES-PAQGASQALSLSGSNAMTLQNNIMNKYL 554
172088180 559 SLSLMFITFIIIMH 572
150375686 559 MMSATLAVIMSAIM 572
192288385 560 HLSSLMLIPLMFFF 573
192288413 560 LLILILMPIIYFVN 573
91176256  552 MVLFVTTLVILLLT 565
5835199   560 MMSSMLLLVATLVA 573
54310667  555 FMSFVALTTLIIMT 568
238866917 555 FMSFVIFTTLIIMA 568
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap