Conserved Protein Domain Family
ND4

?
MTH00204: ND4 
NADH dehydrogenase subunit 4; Provisional
Statistics
?
PSSM-Id: 164750
View PSSM: MTH00204
Aligned: 35 rows
Threshold Bit Score: 531.176
Threshold Setting Gi: 200004086
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
124286765   6 NWLGLIFLLLILGIISVIRIPSDNDARLKTAALEWSLATLAATLILWGAFDSGGQFQTINQTEWVVSPAFksglisqdlp 85 
107736219   1 MILTCIVGSILISIIIIALIPRENSMKLRQQALEWSLITFALSILLLVNLHQEAQFQQIIEFSWVSTIGW---------- 70 
109156452   1 MILACIVGSILISIVIIALTPRENNIKLRQQALEWSLITFALSILLLVNLHQEAQFQQIIEFNWVSTIGW---------- 70 
115531581   1 -MILLISTVLITSIFLVMLVGNSNPLLSKKIALGSSFLVLWLSIVLWTSHNTESLFYSNIITGWLASVPL---------- 69 
164565482   1 --MVLIYLIVIMALVNIIGTARERRCVLKKRALEWSLALLFSTLVFWGGFDGESHFQFFSLVEWNIFSTL---------- 68 
189095619   1 MILTCIVGSILISIVIIALIPRENSMKLRQQALEWSLITFALSILLLVNLHQEAQFQQIIEFSWVSTIGW---------- 70 
192293785   1 MILTCIVGSILISIVIIALIPRENSMKLRQQALEWSLITFALSILLLVNLHQEAQFQQIIEFSWVSTIGW---------- 70 
197259886   1 --MVLFYLILFIGILNVMGVSREKKNLLKKRALEWSLALFFSALVFWSGFDGEGHFQFFSLVEWNIFSIL---------- 68 
197253933   1 --MVLIYLIVIMALVNIIGTARERRCVLKKRALEWSLALLFSTLVFWGGFDGESHFQFFSLVEWNIFSTL---------- 68 
200004086   1 MYIIFLLLIPFLSILNILFLKRNSSNIFN-ISLSWSLILLLYYIVFFVLNYRIFNFQFSIDFNWLLINSI---------- 69 
124286765  86 fpgNFQWGPIVLAVDGISLFFFILTALLIPICILISWNSIKYLLKEFLLCLLFLEILLMGVFSALDLLLFYILFEGILIP 165
107736219  71 ----FEGSPVLFAIDGISIFFIVLSTLLTPICILVSWNSIKFLVKEFIMCLLGIELLLIGVFSTLDLLIFYVLFESILIP 146
109156452  71 ----FEGSPILFAIDGISIFFIVLSTLLTPICILVSWNSIKFLVKEFIICLLGMELLLIGVFSTLDLLIFYVLFESILIP 146
115531581  70 ---STDWGSLYFGVDHLSLPFILLTAILTPICIIISWNSITYLVKEFLVFLLAIHLLLIGVFTSLNILLFYIMFEGILIP 146
164565482  69 -----DWGPIVFAVDGVSLVFLLLTTFLIPICILISQKSIKFLFKEFLLCLFFLEVLLIGVSIVFDLLLFYLFFEGILIP 143
189095619  71 ----FEGSPILFAVDGISIFFIVLSTLLTPICILVSWDSIKFLVKEFIICLLGIELLLIGVFSTLDLLIFYVLFESILIP 146
192293785  71 ----FEGSPILFAVDGISIFFIVLSTLLTPICILVSWDSIKFLVKEFIICLLGIELLYIGVFSTLDLLIFYVLFESILIP 146
197259886  69 -----DWGPIVFAVDGVSLVFLLLTTFLIPICILISQKSIKFLFKEFLLCLFFLEVLLIGVFIVFDLLLFYLFFEGILIP 143
197253933  69 -----DWGPIVFAVDGVSLVFLFLTTFLIPICILISQKSIKFLFKEFLLCLFFLEVLLIGVFIVFDLLLFYLFFEGILIP 143
200004086  70 ---FVNWNNFILSVDGISIFFIGLSILLIPICILISLRSIKYFKKEFNILLFISVILLIGVFSILDVLWFYILFESILIP 146
124286765 166 VFLLIGIWGSREEKVRASYYFFFYTLMGSVFMLLGIFQLYDIAGTTDYQTLLNIKLPESTQKWIFAGFFLSLAVKIPKVP 245
107736219 147 MFLIIGVWGARAEKIKAAYYFFFYTLVGSILMLLSIAVIYRITGTTDYLSLTNIQIDSNIQIWLFIGFFLSLAVKIPMIP 226
109156452 147 MFLIIGVWGARAEKIKAAYYFFFYTLVGSILMLLSIAVIYRITGTTDYLSLTNIQIDSNTQIWLFIGFFLSLAVKIPMIP 226
115531581 147 MFLMIGIWGSRKEKERAAFYFFFFTLAGSLFMLLGIFTIYKHTGTLDYTILSLQTLPSELQFWVFIGFFLSLAVKIPKIP 226
164565482 144 MFFLIGIWGSREEKVRASFYFFFFYFYRLSLFFFIILFLYQRIGTTDYFLLLNIKLFLNIQKWALVGIFLNFAVKLPLIP 223
189095619 147 MCIIIGVWGARAEKIKAAYYFFFYTLVGSVLMLLSIAVIYRITGTTDYLSLTNIQISTSIQIWLFTGFFLSLAVKIPMVP 226
192293785 147 MFLIIGVWGARAEKIKAAYYFFFYTLVGSVLMLLSIAVIYRITGTTDYLSLTNIHIYTSIQIWLFIGFFLSLAVKIPMVP 226
197259886 144 MFFLIGIWGSREEKVRASFYFFFFYFYRISLFFFIILFLYQRIGTTDYFLLLNIKLFLSIQKWALVGVFLSFAVKLPLIP 223
197253933 144 MFFLIGIWGSREEKVRASFYFFFFYFYRLSLFFFIILFLYQRIGTTDYFLLLNIKLFLNIQKWALVGIFLSFAVKLPLIP 223
200004086 147 VFIMIGIWGYREEKIKAAFYFFFYTLIGSLLMLISIFKLYSLIGTTNYENLLIIKIPYDIQFWLFIGFFIGLAVKIPMVP 226
124286765 246 FHIWLPQAHVEAPVSGSVILAGVLLKLGGYGFLRFSWPLLPAASEYFAPLIITLSGIAIVYGSLTTCRQVDFKRLIAYSS 325
107736219 227 FHIWLPLAHVEAPLAGSVILAGILLKLGGYGFIRFAWPIFPEATEYLAPIILTLSLIAVIYGSLTTCRQVDAKRLIAYSS 306
109156452 227 FHIWLPLAHVEAPLAGSVILAGILLKLGGYGFIRFAWPLFPEATEYLAPIILTLSLIAVIYGSLTTCRQVDAKRLIAYSS 306
115531581 227 FHIWLPQAHVEAPVAGSVLLAGVLLKLGGYGFLRFSWTLFPVASQYFSPVIILLGSIAVIYASLSTCRQTDAKKLVAYSS 306
164565482 224 FHIWLPQAHVEAPVAGSVILAGILLKLGGYGLFRFSWPLFPGGSLYWSPVIVFFSVVAVVYGGLMTCRQIDFKRLVAYSS 303
189095619 227 FHIWLPLAHVEAPVAGSVILAGILLKLGGYGFIRFAWPIFPEATEYLAPIILTLSLIAVIYGSLTTCRQVDAKRLIAYSS 306
192293785 227 FHIWLPLAHVEAPVAGSVILAGILLKLGGYGFIRFAWPIFPEATEYLAPIILTLSLIAVIYGSLTTCRQDDAKRLIAYSS 306
197259886 224 FHIWLPQAHVKAPVAGSVILAGILLKLGGYGLLRFSWPLFPGASLYWSPVIVFFSVVAVVYGGLMTCRQIDFKRLVAYSS 303
197253933 224 FHIWLPQAHVEAPVAGSVILAGILLKLGGYGLLRFSWPLFPGASLYWSPVIVFFSVVAVVYGGLMTCRQIDFKRLVAYSS 303
200004086 227 FHIWLPQAHVEAPIAGSILLAGILLKLGGYGLIRFCYPIFPSASQFYYPLIIIISIIAIVYGALTTCRQIDIKRLIAYSS 306
124286765 326 VAHMGLVTLGLFTHTIEGLVAAVFLMLAHGIVSSALFIAVTFLYERHHTRLIKYYRGITITMPIFATMMLVLTLTNMAIP 405
107736219 307 VAHMGIVTIGLFTHTMEGLIASIFLMIAHGVVSPALFIAVTLLYERHHTRLVRYYRGVVMTMPLFSIVFMVFTLANIAVP 386
109156452 307 VAHMGIVTIGLFTHTMEGLIASIFLMIAHGVVSPALFIAVTLLYERHHTRLIRYYRGIVMTMPLFSIIFMVFTLANIAVP 386
115531581 307 VAHMGLVTIAIFSRTSEGLVAAIILMLAHGFVSSGLFITVTNLYDRFHTRIIRYYKGVVYTMPIYSTLFFLLILANIAFP 386
164565482 304 VAHMGLVPLGLFTHVIEGLIGALFLMLAHGFVSSALFIGVTFLYDRHHTRLIKYYRGLTLTMPLFVITMLILSLANMGFP 383
189095619 307 VAHMGIVTIGLFTHTMEGLIASIFLMIAHGVVSPALFIAVTLLYERHHTRLVRYYRGVVMTMPLFSIVFMVFTLANIAVP 386
192293785 307 VAHMGIVTIGLFTHTMEGLIASIFLMIAHGVVSPALFIAVTLLYERHHTRLVRYYRGVVMTMPLFSIVFMVFTLANIAVP 386
197259886 304 VAHMGIVPLGLFTHVIEGLIGALFLMLAHGFVSSALFIGVTFLYDRHHTRLIKYYRGLTLTMPLFIITMLILSLANMGFP 383
197253933 304 VAHMGLVPLGLFTHVIEGLIGALFLMLAHGFVSSALFIGVTFLYDRHHTRLIKYYRGLTLTMPLFVITMLILSLANMGFP 383
200004086 307 VSHMGLVTVGIFSHSIEGLTGSILMMIAHGLSSSGLFIITSIIYFRFHSRIIKYFRGLTITMPILSIITFILILANISFP 386
124286765 406 LSCNFVGEFFSLLAAFEYSLVIGVLAASGMVLSAAYSLYLYNRICFGDASNYHLFPRDLNRREALAMAPLVILIFFLGIL 485
107736219 387 LSCNFVGEFLSLVAAFSTSTSLGVLTSTSMVIAAAYSLYLYNRICFGQLSPYLIFSRDINRREFNGQLPLIVAIVLLGVV 466
109156452 387 LSCNFVGEFLSLVAAFSTSTSLGILTSTSMVIAAAYSLYLYNRICFGQLSPYLIFSRDINRREFNGQLPLIVAIVLLGIV 466
115531581 387 ISMNFVGEFMSILSALQFSLLAILCPLAGMVLSAAYSLLFYNKVSFGYPSSFLQFARDVNRRELWPPLLLIVLTITLGVM 466
164565482 384 LSCNFVGEFFSLLAVFQYHYGVGMFVILGVLFSAIYSLSLFNRISFGGGSNYLLFNRDLSRREISVIFPFLLIILGGGIV 463
189095619 387 LSCNFVGEFLSLVAAFSTSTSLGVLTSTSMVIAAAYSLYLYNRICFGQLSPYLIFSRDINRREFNGQLPLIVAIVLLGIV 466
192293785 387 LSCNFVGEFLSLVAAFSTSTSLGVLTSTSMVIAAAYSLYLYNRICFGQLSPYLIFSRDINRREFNGQLPLIVAIVLLGIV 466
197259886 384 LSCNFVGEFFSLLAVFQYHYGVGMFVIFGVLFSAIYSLSLFNRISFGGGSNYLLFNRDLSRREIFVILPFLLIIFLGGIV 463
197253933 384 LSCNFVGEFFSLLAVFQYHYGVGMFVILGVLFSAIYSLSLFNRISFGGGSNYLLFNRDLSRREIFVIFPFLLIILGGGIV 463
200004086 387 LTLNFIAELFLIISAFKFSLFIILLILLGVFINLIYSLWVYNRIFFGSNSIHLKFSRDIVNFEFQSLLPLIIFIIILGIY 466
124286765 486 PSVIIGPVKNAIMFSPGG 503
107736219 467 PYPLIELIRVCL---PRF 481
109156452 467 PYPLIELVRVCL---PRF 481
115531581 467 PTCLDLTLCLPYIY---- 480
164565482 464 PFPIIDLIKNSLVFSPGG 481
189095619 467 PYPLIELIRVCL---PRF 481
192293785 467 PYPLIELIRVCL---PRF 481
197259886 464 PFPIIDLIKNSLIFSPVG 481
197253933 464 PFPIIDLIKNSLVFSPGG 481
200004086 467 PNILINPITFSSYINISI 484
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap