Conserved Protein Domain Family
ND2

?
MTH00200: ND2 
NADH dehydrogenase subunit 2; Provisional
Statistics
?
PSSM-Id: 177246
View PSSM: MTH00200
Aligned: 42 rows
Threshold Bit Score: 138.178
Threshold Setting Gi: 50812498
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5835475     1 MNPIVFSLLSLTVI-AGTLLVLTASNWFFIWLGLEINTLAF---LPLLISTHHP-------RATEATTKYFLIQALASAL 69 
157384905   1 MWVVGFPVLLVLLGvVGLLLVLGGGGIISVWIGAELVSLAVgmgVLALGAGGYC-------TKVVVLMKYLFLQMIMGAL 73 
157384921   1 --MGVLGLMVVGLWvVGMAYIVGGGSVFGVWVGVEFVSLVVgmgILVWGGGGFV-------TKSVVMMKYLMLQMVMGAC 71 
55979251    1 MSPYISPLFSLGMF-ISVMLILCSSHWIFLWMGLELGTLAF---VPMLAWWHTS-------LEVEATVKYFIVQALAAAT 69 
5881427     1 MSPYISPLFSITMI-MSVMLISSSGHWVFMWLGLELGTLAF---IPILVWWHSS-------LEVEATVKYFIVQAMAAAV 69 
5835515     1 MSPYISPLFSITMI-MSVMLISSSGHWVFMWLGLELGTLAF---IPILVWWHSS-------LEVEATVKYFIVQAMAAAV 69 
28436203    1 ------------------------MIFFFIWIGMEMISLLL---LGFLFLKKSLkingigfQKMGVLVKYMFIQIISGMV 53 
27228447   12 KIGVMLNFLKISIV-FGFMIILSLSDFFPLWVGMELISLLI---LGFIFLKKATeiggigfQKFGVLIKYMFLQIFSGMI 87 
50812498    1 ---------MMGMV-LGTLMVISTSSWVVLWMGMEVNLMSF---IPFLK--------------KQNAMTYFIIQSVGSLM 53 
55338250    1 --------MIFGMI-FGLVCAVSSNNWLLIWLGLEINLMSF---LPLISQNLGS-------KK--KVSLYFVVQSFGSLL 59 
5835475    70 LLFG-------------GLLQASQFNSWNTDTQLLPATT-----------ILLIAAVTLKMAIAPCHGWLPDVLQGLPFR 125
157384905  74 LLL---------------LLLGVGEGGLGPEALVS----------------GILVVILFKLGAFPGHLWVIDVYGGLSLW 122
157384921  72 LLLG-------------LLV-------WGAPVGLDPLVG-----------WMVVLVISVKMGTFPGHSWVVDVYGGVSLW 120
55979251   70 FFFG-------------GLMNMNVVYTSDVSHWFGGVGE-----------MIILLAVAVKLGMAPFHYWVVDVVQGLNYI 125
5881427    70 FFLG-------------GMVSLSGDFMGGVNQLMGNIGD-----------MMIMLAVVTKLGLAPFHYWVVDVVQGLNYI 125
5835515    70 FFLG-------------GMVSLSGDFMGGVNQLMGNIGD-----------MMIMLAVVTKLGLAPFHYWVVDVVQGLNYI 125
28436203   54 IFFS-------------FILSSFLFDVFKLGYSLGSNTEngfymiewlfkFMFFFSIFMKLGLFPGHLWVIDIFSGLSQQ 120
27228447   88 ILFSfslsnlmfdftkiGLSFGMYSQYFGINMLMELFN------------FMFIFSIAMKLGLFPGHLWVVDVFSGLTFH 155
50812498   54 ILFG------------------------GVYQFMSSMMF-----------FLLLLGIITKMGLMPLHFWVPLVMKFNPPQ 98 
55338250   60 ILAV-------------GIMQL-------------NLTT-----------LILIMALSLKMGLIPFHFWVPPLITTMKSN 102
5835475   126 IGLILSTWQKIAPFSILLLLPTQPT-WVFFTLGLLSVIIGGWGGLNQTHIRKLLAYSSIAHLGWIITIYPLSSQISTLTL 204
157384905 123 GGLVLGTVPKIGLLAALALFGWGAG-LTLEFMSVMSVVVGGILGIGTTDVRHMLACSGVVSVGWLLVGSSGGTGGLLWLF 201
157384921 121 EGLVLGVVPKVGLFVALTLFAWGVG-MSVEWVALMSVGVGGMLGLGYTDIRHIFACSSVVTSGWLLVGMVGGGFF--WIF 197
55979251  126 PGLVLLTWQKLPGLAVFIQLGCSNP-TLIAVLGCLSALVGGLGGLGQTQLRKLLAFSSIVHLGWLVTGVGVNSLLGMTYF 204
5881427   126 PGAVLLTWQKVPGLAVLTQLATCNNsSMLLLFGMVSALVGGLGGLGQTQMRKLLAFSSISHLGWLVVGCVAGSLLGLSYF 205
5835515   126 PGAVLLTWQKVPGLAVLTQLATCNNsSMLLLFGMVSALVGGLGGLGQTQMRKLLAFSSISHLGWLVVGCVAGSLLGLSYF 205
28436203  121 ECFLLGIIPKYAPFMLLTGFNYD---IFLTCVGTLSILSGSFIGLNYTDIRQIMGGSSIMNTGWLLMGMVYGGLG--VFL 195
27228447  156 ECFLLGTIPKYAPFLLLNGDYYELN-SLLMLMGSFSILFGSFQGLNYSDLRQIMGGSSIMNTGWLLMGFLFGGLN--MFF 232
50812498   99 IFLLLLSWQKLNPLILLSFLP-----NSMFIIIFINSLLGGFFSLLSSSIPTLIMFSGFVHWSWILSLI--SSNLHMMYF 171
55338250  103 TMTLLSTAQKVSPLVLLKV---ALNsSALMLLLVMNAMMGGMMVMSSMMMPLLFLFSGTIHLSWLISAL--NTIMFWEYV 177
5835475   205 VLYFFLTGTLFLALHFLNTPSLADLGNIVNLAPWLT-TLTLFTTLSLGGLPPLTGFLSKWLILQELSLNTNLVIATTLIM 283
157384905 202 LMYVLVLLGVVVLLEVGVYIALKLSSSSFYGGTGVG-FNSGIGVLLVLGLVGMPCSVMFIFKVCTLMIYGLGAFVGVVLL 280
157384921 198 LMYVAAMLGVVLLLEVGVHMLYKLSSSSFVGGVVGG-QKSGFLVLLLLGLCGVPLSLMFLFKLTTLSLYGVGWYTAMVLL 276
55979251  205 VLYVSVSLPIFLFLHIMNVVHVNQLRSGIVGSPVVT-ALLSLGVLSLAGLPPFVGFLGKWLVLTELVSQTMVLVSAVLIS 283
5881427   206 TLYVVLSIPLFSILHMLNGGHLNQLRTGLMFNPLMS-VLLGVGFLSLGGLPPFFGFFGKWLLLTHFVGQLLLGVSVVLIT 284
5835515   206 TLYVILSIPLFSILHMLNGGHLNQLRTGLMFNPLMS-VLLGVGFLSLGGLPPFFGFFGKWLLLTHFVGQLLLGVSVVLIT 284
28436203  196 FMYVIYSLSVWLMFTFTENLGIQSLVLHNL-SRMEK-MMFCLLMFIIMGMPCGIMFFFKIFLIMN--GGNFFFFTFLMLM 271
27228447  233 WMYLVYSYSLWVLFNLVKVLNIQTLGAYKTWLSYTDkMLFSFIMFVIMGMPCGVMFFYKIFLIMGSNNIFFFFF---LML 309
50812498  172 SVYMIIIFFLYIYYYK-------------------S-YLFMMSLLNFAGVPPMPGFFLKLFSMMFISKNYIF----FLLM 227
55338250  178 LIYMILLSAIIMFWDFNQKNSM------------------QLTLLNFGGIPPFLGFSLKLKTLANLNQFHIP----ALLT 235
5835475   284 ASLISLFF-----------YLR---ITYIILLTLSPQHTTISLTWRTAQsaslANILLAALLTISIAGLALPPSWLPLFF 349
157384905 281 ASFFGAVM-----------YLRfftISWGSLGVVSPAWGSSRSLWGLLVlgslAGFLVGLILLFYLVF------------ 337
157384921 277 LSFFSAFM-----------YSRlfvVSWGGASSGGLGGGDLL--WGGGVwgsgGGLLVVLVSVVGVVGLLLMFFVVL--- 340
55979251  284 GTLVSLYY-----------YLR---VGYLCLAIMSPQQVMVNTSYRKSF----IFNILAVLVGFNLIGLATSSGVSCYI- 344
5881427   285 GTLISLFY-----------YLR---VSYLCIVVLGPQQIMSGLNWRKMQ----LSGLMSGLLVLNMLGLFLVGGASCLPK 346
5835515   285 GTLISLFY-----------YLR---VSYLCIVVLGPQQIMSGLNWRKMQ----LSGLMSGLLVLNMLGLFLVGGASCLPK 346
28436203  272 GYTMFVFYsrtmsqvwnydYRN---IHFNISTLSSNNSI--------------KSRYVMSLVMMNFSGMIILFKFL---- 330
27228447  310 AGYTMFVF-----------YSRmmsQVWNYDFFGTNFMYTSMNRYGAA-----INKYVTSLILLFFPGLILLYKFL---- 369
50812498  228 GSVLMLTA-----------YIR-----------------SMMIFFKEKShnynGILFMLFFMLLPSLMLA---------- 269
55338250  236 GSCMSLYA-----------YVR---LLVTGMM---------------------SHKKKVAEKLSPVAILLLIPQ------ 274
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap