Conserved Protein Domain Family
ND2

?
MTH00199: ND2 
NADH dehydrogenase subunit 2; Provisional
Statistics
?
PSSM-Id: 177245
View PSSM: MTH00199
Aligned: 22 rows
Threshold Bit Score: 441.763
Threshold Setting Gi: 164421201
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
62161307    1 MVIMSPEVLLSIVVLGLVLYGIN-FSTFKASIGVLLIIGIMISFgfpm-eistISVEESVAFNAIHWTGGLLMVNSW--- 75 
126695323   2 YEAFYPELFLSLAVLILVIYGVY-QPTLKTAIIVLLITGLIALP---------NEQFLFWEDKTLDLTNGLLTINSW--- 68 
164420984  10 YIIIYPEILLSLMVLSLVIYGVNpLSTFKIAVIILMVIGTWVSVvgfgdfgenSYLNIAQSFXLCHITNGLLMIDGW--- 86 
163854299   1 MLGIFPELLLSLVVLILVVYGLK-GRILKLSIVLLIFVVLMSYW-----------------LRVDFGANGLLLTNGW--- 59 
164421171   1 MLLLWVDGLMVGVLLLLVLGGVR------GAIGKWLLLLLIVEL-------------------------GICLAGGWggs 49 
164421147  10 YIIMYPEILLSFIVLGLVIYGVNqLSTLKITVIVLILMGIWVSLvelgdfgenFSLNVAQSFWLCHITNGLLMINGW--- 86 
164421022   1 MLDLFRELLLSWVILILVVYGLK-GRLLKVSILMLIIVGMISLW-----------LRAELVYTVDYGINGLLLTSDW--- 65 
164421047   2 YEGYYSEWLASIAILILIVYGVY-QSTLKTAVIVLFLTGFLIFF---------NNQLLFWEGKVFDLTNGFLTINSW--- 68 
164421186   6 NIIINPEILLSLVVLCLVLHGIR-LPILKLSVIVLFLIGIITGFnla----glDSFETITIIKYSYITNGLLDTNNW--- 77 
281428843   1 MLILWMDGLMVGVLLLLVLGGVR------GAIGKWLLLLLIVEL-------------------------GICLVGGWggs 49 
62161307   76 -----------IIISKIIIIIGSISILLLctlpdnapdwsggavydrpirtdrhhsgntsiiphgrpiedrgagggLRPP 144
126695323  69 -----------ISITKLIIIIGSISILLM-----------------------------------------------LKDT 90 
164420984  87 -----------ITISKVIIVIGSFSVILM--------------------------------------------------- 104
163854299  60 -----------VDISKGVLIMACVLLLLM-----------------------------------------------YSYK 81 
164421171  50 islnvlcgrllIIITSILIVVGNLKEVFI--------------------------------------------------- 78 
164421147  87 -----------ITISKIIIVIGSFSIILM--------------------------------------------------- 104
164421022  66 -----------VDISKGLLVIVCVSLLLM-----------------------------------------------YSYK 87 
164421047  69 -----------VYIIKLIILIGTISILLMl---------------------------------------------kKTSL 92 
164421186  78 -----------IIISKFIIIIGSISILLM-----------------------------------------------GISE 99 
281428843  50 iglnvlcgrlfIIITSILIVVGSLKEVFI--------------------------------------------------- 78 
62161307  145 IPLlespigsnwSEGFTSSPILILIVALSSLLLVSSVNWLSIXLAIELQTLTLFILAALKRDSAYSTEAGLKYFXLGAVS 224
126695323  91 KIS---------GQVSFDYPVLILIVTLGSVLLVSSINWLSVYLAIELQTLSLFVLTALKRDSAYGAEAGLKYFVLGALS 161
164420984 105 -GQ---------SSGLSSSPVLILIVTLSSLLLISAINWLSLYLALELQTLSLFILVALKRDSAYSTEAGLKYFVLGALS 174
163854299  82 NQE---------REEGDSWIMLVLIVLLGSLLLVSSVNWLSIYLALELQTLALFILVAIKKNSAYSTEAGLKYFVLGAVS 152
164421171  79 ---------------------INIFVIFGAFILVSSENLIMIYLGLEMQNLGLFVLLGRGR-GVRGVEGALKFFILGAVS 136
164421147 105 -GQ---------SSGFPSSPVLILIVTLSSLLLISAINWLSLYLALELQTLSLFILVALKRDSAYSTEAGLKYFVLGALS 174
164421022  88 SQE---------KEGGDSWIMLVLIVLLGSLLLVSSVNWVSIYLALELQTLTLFILVAIRKNSAYSTEAGLKYFVLGAVS 158
164421047  93 ISQ---------GLILFDFPVLVLIVALGSMFLVSSINWLSIYLAMELQTLSLFILVAFKRNSAYGAEAGLKYFVLGALS 163
164421186 100 TIL---------IKSYQYFSLLILILTLGALLLVSSINWLSIYLVIELQTLILFILTALKRDSAYGTEAALKYFILGALS 170
281428843  79 ---------------------INIFVILGAFILVSSENLIMIYLGLEMQNLGLFVLLGRSR-GLRGVEGALKFFILGAVS 136
62161307  225 SGVFLFGCALLYGLTGETSIQG---INSILT-ADVGKILITISLLFKLSAAPFHMWAPDVYDGAPTTTTALLAIVPKVGV 300
126695323 162 SGLFLFGCALLYGLTGETSIHAggqICALTSnGEAGKILITISLLFKLSAAPFHMWAPDVYEGAPTTTTALLAIVPKVSV 241
164420984 175 SGLFLFGCVLLYGLTGEVSVQG---IAALAAgGEIGRIFITISLLFKLSVAPFHMWAPDVYEGAPTIITALLATVPKISV 251
163854299 153 SGLFLFGCALLYGVSGETSIQG---INSILI-GDVGKILITVSLLFKLSVVPFHMWAPDVYEGAPTITTALLAIMPKIGV 228
164421171 137 SAVFLLGVAFVYGGSGEVCFLG---NNYIGLlENWGRGLITVALLFKLTMVPFHFWAPDVYGGASFYTILLLVTIPKISI 213
164421147 175 SGLFLFGCVLLYGLTGEVSIQG---VNLLLE-GEIGRIFITISLLFKLSVAPFHMWAPDVYEGAPTTITALLATVPKIGV 250
164421022 159 SGLFLFGCGLLYGVSGEMSIQG---INSVLI-GDVGKILITVSLLFKLSAVPFHMWAPDVYEGAPTITVALLAVMPKIGV 234
164421047 164 SGLFLFGCALLYGLVGEMNLQAgerICALTLdGETGKILIIISLLFKLSAAPFHMWAPDVYEGAPTITTALLVIVPKIVI 243
164421186 171 SSLFLFGCGLLYGLVGETSVQG---INSILT-IDVGKILITISLLFKLAAAPFHMWAPDVYEGAPTIITALLATVPKVGI 246
281428843 137 SAVFLLGVAFVYGGSGEVCFLG---NNYIGLlESWGRGFITVALLFKLTMVPFHFWAPDVYGGASFYTILLLVTIPKISI 213
62161307  301 FSILVQIGPITNVVLLCAIFSIIYGAIGALNQTKIKRLLAYSGIGHIGFIXFGVAIGSFESIQASLIYLIIYVIMSICSF 380
126695323 242 FAILVQIGPVINVLLASATLSMIYGAIGALNQTKIKRLLAYSGIGHIGFVLFGVTIGSFESIQASLIYMIIYVIMSICSF 321
164420984 252 YSILVQIGPTTNVILICAGISIIYGAIGAINQTRIKRLLAYSGIGHMGFILFGVAIGSFESIQASFIYMIIYVIMSICSF 331
163854299 229 FSILVQVGLVSNIVLFCGVLSIIYGAMGALNQTKMKRLLAYSGIGHMGFLLLGVGIGSFESIQASLIYIIIYVIMSVCGF 308
164421171 214 FYLLMQVGFEDQIVVWCVALSLLVGGIGGLNQASMKKLFVYSGMINMGMVLWGLLVGGNSGIVISFVYLIIYMIVSIGIF 293
164421147 251 YSILVQIGPTTNVILICAVISIIFGAIGALNQTRIKRLLAYSGIGHMGFILFGVAIGSFESIQASFIYMIIYVIMSICSF 330
164421022 235 FSVLVQAGLVSNVVLFCGVLSIIYGAIGALNQTKMKRLLAYSGIGHMGFIIFGVAIGSFESIQASLMYIIIYVIMSICGF 314
164421047 244 FAILVQIASVVNVLVASAILSLVFGAIGALNQTKIKRLLAYSGIGHMGFVLLGVAIGSFESIQASLIYMIIYVIMSICLF 323
164421186 247 FSILVQIGPVINVILISAVLSIIYGAIGALNQTKIKRLLAYSGIGHMGFILLGVAIDTFESIQASLIYIIIYIIITICSF 326
281428843 214 FYLLMQVGLEYEIVVWCVILSLLVGGIGGLNQASMKKLFVYSGMINMGMVILGLLVGGNSGIVISFVYLIIYMIVTIGVF 293
62161307  381 SIILSLKLTKDLIIEVSGLSRDNPVMALTLALTLLSTAGVPPLAGFLSKWLILLSGVSNGYYLTCIVAVVSSVIAGVYYV 460
126695323 322 SIILTLGLSKNLLVEFSGLSRRHPIMAVTLALTFLSIAGIPPLAGFFSKWLVLLCGISSQYYLTSIVAVLCSVIAGVYYV 401
164420984 332 SLILSLNLRRGFLVELSGMSRNNPVMAMTLAVVLFSIAGIPPFAGFLSKWFVLLAGIYGGYYLISLLIVISSVIAGVYYV 411
163854299 309 SVLLSLKLTRALIIEVSCLSRENPVMALTLGLTFLSMVGIPPLAGFLGKWLILLSGVSSGYYLICMMVVVASVIAGVYYV 388
164421171 294 FILLQLKWRSGLIVELVGVGRKNAVLGVSFILLFFTLAGIPPFGIFFVKLWIIMSVLMSGGWLLAVGLVLVSVIAGVFYV 373
164421147 331 SLILSLNLSRGLLVELSGISRNNPVIAMTLAVVFFSIAGIPPLAGFLSKWFILLSGIYGGYYLFSLVVVISSVIAGVYYV 410
164421022 315 SVLLFLKLTRALIIEVGSLSRENPVMALTLGLTFLSTAGIPPLAGFLGKWLILLSGVSSGYYLTCMVIVMASVIAGVYYV 394
164421047 324 SLILSLKLRKPLIIEFSGISRVHPIMAISLALTLLSIAGIPPLAGFFSKWLILLYGVTSQYYLISIIAVVCSVIAGMYYV 403
164421186 327 TIILSLNLTKNLIIEISGLSGDNPVIAATLALTLFSVAGIPPLAGFLSKLLILLSGVLNGYYLITIIAVISSVIAGVYYV 406
281428843 294 FILFQLKWGSGFIVELVGVGRKNSVLGVSFILLFFTLAGIPPFGIFFVKLWIIMSVLMSGGGLLAAGLVLVSVIAGVFYV 373
62161307  461 RLVQIIYFQADYSILIWQKVLK----KEXRVDLSKSFLIGLSFFLILFLMISPNFLLQITHDATISLY 524
126695323 402 RIVKIIYFQAESSLLIWKDVLI----RDKREEFRKSILIGLTLYIILFIMISPNLLLQIAHDATMGLY 465
164420984 412 RVVKLLYFQTDSPLLVWQRVLN----RENGADFPRSILIGGTLFFILFFMLCPNFLLQITHDATICLY 475
163854299 389 RVVQIIYFP-SYSLLTWQKAIN----RLEVINLRKSILLGVVFFIILSLMVSPNWVLQMTHDATISLY 451
164421171 374 RVISIIYENAAWGDRLWGALS-----KREWLLLFPWVLIGMFAFFTYFYWLVLYWGLVVFDGFLEGLK 436
164421147 411 RIVKLLYFQTDSPLLVWQRVLN----RESGVDFTKSILIGVTLFLILFFMICPNFLLQITHDATICLY 474
164421022 395 RVVQIIYFP-NYFLLTWQKVIN----RLEVINLRKSILLGVAFFIILFIMVSPNWVLQVTHDATISLY 457
164421047 404 RIVKIIYFQIGSSSLIWQYVLT----DDKIESLSKFLLIGFSLFFILFFMSSPNFIMLISHNATMGLI 467
164421186 407 RLVHLIYFPINYSILIWQNILI----KQRNINLSKSILIGITFYIILFLIITPNFLLQISHNAVISLY 470
281428843 374 RVISIIYEK-----AAWGDRLKgilsKREWLLLFPWVLIGMFAFFTYFYWLVLYWGLVVFDGFLEGLK 436
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap