Conserved Protein Domain Family
ND2

?
MTH00197: ND2 
NADH dehydrogenase subunit 2; Provisional
Statistics
?
PSSM-Id: 177244
View PSSM: MTH00197
Aligned: 9 rows
Threshold Bit Score: 206.447
Threshold Setting Gi: 164420830
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
190349585   1 MLFLSIIFLTVIFQISSLSWFSIWIAMELNLLSFIPLLSTPYNILYNEGSMKYFLIQVFGSIILLMGwlsGSLMFFNVm- 79 
169794175   9 FFFLFFMVLGVFVSLSSSNIFLVWCGLEMNLMGFIPLMIQLKNLGEVEAAVKYFLVQSFGSAMILMG---GILYFYDVg- 84 
169794161   7 FFFLFFMVFGVFFSLSSSNWFLVWCGLEMNLMGFIPILIQFKGLSEIESAMKYFLVQALGSAMVLFG---GVYCFFNLfs 83 
6691421     5 SMFYISSLIGTLMALSSSTWFFIWIGMEINLISFVIILTQAKARQENFMAFIYFLFQEVGSYLLLVG---VMLSLLPL-- 79 
8404666     1 MVLYAGVFGEVGLSLAASNWILVWVGFEVSSICFVVLLSCSSSCTEIYSAFTYFLFQEIGSYLVLIG------------- 67 
15341662    5 FLFHIVLVGGILLSLSSDSLLLVWVGLELSSICFIALLSQNRSISEMVGCYSYFLFQEVGSYFFLVGglgGWGAFSDL-- 82 
164420830   9 FVFSFTNITGLTMIISSPNWLTMWIGFELSLLGFLPMFIMNKSSID--SMVKYLLLQSGGSALMLASmiiNSAIQSEN-- 84 
219524193  12 FIYLSLIFFSIIIIISSNNWFFTWMGMELSLFGFLPIFTFNQTTTE--GLMKYFLMQASGSAMFLIS---CLSTLNNI-- 84 
299827789   1 MLFYLILFMSIMFQISSTTWFSLWVAMEMNLLSFIPLLSNPKNMLFNEGPMKYFLIQAFGSVILLMGwlmNSYSYLNNm- 79 
190349585  80 YGDEFSNLLFYVSLILKMGAAPFHFWFPLVLESLSWMNSFLMMTWQKLGPLMLLS---FINKLMFLLMMSSIFSSLIGGF 156
169794175  85 FFSLGFSVLIFSGLFVKLGVFPFYFWLPSVMISLDWVSCTLIATWQKVAPFGILM---TLSHSELSLISFGVMSSLVGGI 161
169794161  84 WTSLLFCLPVIIGLMIKLGVFPFYFWLPGVMMNMSWLSCLLLATWQKIAPLGILIs--FFYSNSMILVWAGVGSSLIGGI 161
6691421    80 PLETLSHWMVITSLSLKIGLIPLHYWVLPAFSSISWFNCLFLIIPQKLAPIFILAqvpLLSSSKIVISICALTSILWGAQ 159
8404666    68 ------VLLVTSGLLVKMGAAPFHMWVPMVVDEVSWFNCFLVLVVLKMVPLLLLT------SRFSGLLVCGVVSVLWGAF 135
15341662   83 ------------GLIVKLGGAPFHIWMLIAVQSVSWVNCFLLLVAQKLAPLFLLG-------HTGGVYWCGLASVVVGAI 143
164420830  85 --------MFLLSILLKIGLFPFFQWVPTIMTTLTWFGCFMIATIQKMGPMIMLLk--KNNNSFMLLLISSTLSILISGM 154
219524193  85 ------VVLTILGMVMKLGIFPFFQWMPAVMVSLSWTGCMLLTTLQKVVPLLILA----NTNNPDMVFICSTLSIMISSV 154
299827789  80 YLFSMSNVIFYISLMLKLGAAPFHFWFPSLMENMSWLNSFLLMTWQKLGPLILLT---YISKLLFFLMMSSFFSSLVGGL 156
190349585 157 GGFNQVSFKKIFAYSSIGHLGWMLISLIMVESYFIMYYMFYILMVFMLCMVLFLKNLSSLNQFLFLSESF-FLEKLFFLF 235
169794175 162 LGMNQVNVKSLLAYSSIGHMGWMISVCKYSMSICMVYLILYLVSNFFIFFLLMKMNFYRMKTIKSVSNMY-SFYMILLGF 240
169794161 162 MGMGQSNLKCLLAYSSIGHMGWMVSISQFSVSISLFYLFIYIMMNFILFVLLQKMNFSWLNSMKKVPYFM-SYYIVLFGL 240
6691421   160 AMMNMTLIRQIIAYSSINQTGWMTMLIVSSPQSFPPYFLIYSTITVALLYPMSQTKARASFSQSNMPDTMdKSSLMFLAL 239
8404666   136 GIVGQAAIRRVLAFSSINQTGWMLLVILYCPGYLGFFYSVYFFIMLGLILFFSYP----------------GGKVSSWGL 199
15341662  144 GMVGQSSVRQILAYSSVNQTGWMLIIAYLSINILKIYFMIYFIIMVLSLLFLHQSIVYEKSGEGSW-----GVGLVGVSL 218
164420830 155 MGLNQTNLRTLLGYSSISHTAWMATSLVKSSKLMTTYLVYYLLISMMLFFFLNKKNLNKINIYYSNN----DPNLPKIIV 230
219524193 155 LGFNQSLMKPLMAYSSISFTSWIIMALWFNLTFGMLFIFFYFVLTLYLFSIFKSNNTMTIYQRYGN-----SKNQKNKNQ 229
299827789 157 GGLNQVSMRKIFAYSSIGHISWLLMSLMLNELNFILYYLFYFFMMFLFSLIFYLNLISSLMQLLFYKESF-YMEKFFIML 235
190349585 236 SLLS-LGGLPPFSGFFVKWMILNSILILKLKFLGLILIMSTLVSLFYYLRISYSVLLKFNlslSFIMQNMKINNYFLMKI 314
169794175 241 SFLA-LAGIPPLLGFFPKLLSIEVLLSSHHSVGTFLLVLGTCFSLYYYISLVLNSYSNSYywnWNKSVLYVNSLGYSLMF 319
169794161 241 GFLN-LGGIPPLLGFFPKLFSVEVLLSSGIYLGTFGLILGTCFSLYYYISMVLNSCLNVLn--WHGNVLKKLDFGFVVLL 317
6691421   240 ALLS-LSGLPPAFGFTMKWLALSSAMSSLSPLLTVLMMIAACVSAYAYLSLAYKTFILAH------NKPMSITPMNYPLY 312
8404666   200 CFLVgLGGFPXTVGFMLKWSVVGGLVQGQVSGLAFMVTILSVLSLFAYVSLGYKILMMNK----------VMGQFYSLYF 269
15341662  219 FLVS-LSGFPPLVGFLFKWGGVTEFIGGGDFLISGCVMVASVFSTYVYFSLGYKILVFSK------LFGFTSSGLVAGLF 291
164420830 231 MLMI-LAGLPPFSMFFLKLAILTQI--SCYSLITSMLILGTALSSYYYLTFIITNLIKSN---------SKKNLLWQGSM 298
219524193 230 SFMI-LSGMPPFSLFFFKMYMFYLMI--NMPLIMIILIVSTYISMYYYLRVAISSMPHTL---IMVKDSKMGHSNFPNSK 303
299827789 236 SFLS-LGGMPPLSGFFVKWMILNSLLIMNIWFISFVMLFSTLINLYYYIRIFYSTMMLSNfspMMISFKFSFKYLYLIKL 314
190349585 315 IILIMMVSLIMIPLMI 330
169794175 320 LVTINLLSLVMLVMMI 335
169794161 318 LLLFNIFGLMILFIFI 333
6691421   313 FLLTAPLTLPLIYTTM 328
8404666   270 VVGMFMIPLVTGF--- 282
15341662  292 LVGVGFPPSYFLWGCL 307
164420830 299 ILAMSHSPLLMIL--- 311
219524193 304 INMIHYLPILYLATYI 319
299827789 315 IILMMMFSVLFIPIGI 330
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap