Conserved Protein Domain Family
ND1

?
MTH00193: ND1 
NADH dehydrogenase subunit 1; Provisional
Statistics
?
PSSM-Id: 177241
View PSSM: MTH00193
Aligned: 215 rows
Threshold Bit Score: 156.083
Threshold Setting Gi: 171260065
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
171473584   3 YFINILSYFFMLLGILISVAFMILFERKVLGYIQIRKGPNKVGFMGILQSFSDAIKLFIKEQMFPSKSNFLLFYLSPVSS 82 
49146490    1 -MIYFLIMILLLISTFLSIAFFTLMERKILSYMQNRKGPNKTLIMGILQPFSDAIKLFSKEMNLNFKSNYIIYYMFPLLN 79 
51830193    1 MMKTLINFLFLIIFTLMSIAFFTLLERKMISYTRNRMGPMKTSFMGTLQPIADAIKLLSKELKMNLKSNTTLFIFLPLID 80 
51830153    1 MIIKIMNFIILMVSVMMSIAFFTLMERKIISYTQNRKGPNKVMMSGILQPISDAVKLVSKELNLNLKANFIIYLISPLLN 80 
52220941    1 MFLATLNFLFLMIMVMISVAFFTLMERKMIGYSQLRKGPNKILMMGIIQPIADAMKLITKEFNMNYSSNFTLYLMAPALN 80 
52220980    1 -MMATINMISIILIVFISIAFFTLMERKVISYTQNRKGPNKSSINGITQPMADAVKLMNKEINMNYKSNFIMFMVSPTIN 79 
213948237   3 MFIMIINFLILFLMVFMSVAFFTLLERKVLGYIQLRKGPNKFLLSGIFQPMGDGLKLFFKEVNYPSNMNFFIFMFSPMLG 82 
226968607   1 ---MFLMQTFILFMSLITVMFITLTERKFLGILNNRKAPNFLLFMSIFQSLNDFLKLISKKILKMNFIMKIYWVMMIFFG 77 
301353325   1 ---MFFMQILIMLMSLITVMFITLMERKFLGILNNRKAPNYLLFMSVLQSLNDFLKLITKKIFKMNFIMKLYWMMMIFFG 77 
51830061    3 MFVMIVNFLILFLMVFMSVAFFTLLERKVLGYIQLRKGPNKLLLKGVFQPMGDGLKLFFKEVNYPSNMNFFIFMFSPMLG 82 
171473584  83 LFIIIYMWMIYPSGSNLINMALGGLFFFCCTSFGVYCLIGSGWSSNSNYSMIGAMRGIAQTISYEVSMALFLLGVIFLVN 162
49146490   80 IICSLMMWMIYPFYWNFNFNKFNILMLMSMMSINMIIIMLISWSSNSNYAMIGLMRSIAQMISYEINLMIIIMTIVNLTE 159
51830193   81 ILISISVWLISPFSSIFNFMKMSFFFLMSCMAINTITILLKSWSSNSNYAMIALIRSVAQLISYEINLIMIIMIIMMLME 160
51830153   81 LLMALMVWASFPFLMTFSFMKMSMLFMISCLSFNSITIMTMSWSSNSNYSFIGMMRSIAQLISYEINFMMIILTVMNICE 160
52220941   81 IICSLLTWIIFPFKYSFSFMKMAVLMMLSCAAFNVVTIMMMSWSSNSNYAFIGMIRTISQLISYEINLIMILITVIIITE 160
52220980   80 ITCSIMMWFIYPSMFSFKFMKMSMVYIICCMSVNIIAVLTMSWSSNSNYSLLGMMRTVSQLVSYEINMMMIILLSINMSE 159
213948237  83 LLISVVFWFIYPYIGMNYIMGFGLIYMFCCSSLMVYIFLMISWSSNSNYSVLGMIRFISQMISYEVSMMIIIMNLMFLIN 162
226968607  78 MTMFLLIMLIFPLNNSLMYLYISFYMFFLIYSFMAFFFLILSYSSNSVYSIMAMTRVLIQIISYEVGMIFLFMLPLFVMN 157
301353325  78 MMMFLLIMMIFPLNNSLMYYYLNFYMFFLIYSLMAFFFLVLSYSSNSIYSMMAMTRVLIQIISYEVGMIFLFLLPLFLLN 157
51830061   83 LLISIFFWFIYPYIGMNYIMGFGMIYMFCCSSLMVYIFLMISWSSNSNYSVLGMIRFISQMISYEVSMMIIIMNLMFLIN 162
171473584 163 NYNF---NLVIKNQEFVWFIYLFLP-LFLCWVTIMMAETNRTPFDFAEGESELVSGFNIEYGSGGFALLFLAEYASIIFM 238
49146490  160 QLNF---NYMFIMQKYMMFYLYLMF-LFYIWIITILAETNRTPFDFSEGESELISGFNIEYSSFSFAFIFLAEYSNILIM 235
51830193  161 QMNLnlsMTLKYLS-----LFISQPmLTIIWMITILAETNRTPFDFAESESGLISGFNIEYASKSFVFLFLAEYSKILCF 235
51830153  161 QMSL---VTTYILQKYISISLIMPM-TLMVWMITILAETSRTPFDFSEGESELVSGFNIEYSSKSFMFLFLAEYSSILFM 236
52220941  161 QMNF---INMSKVQKYIQITMLLFP-LVLIWLITILAETNRTPFDFSEGESELISGFNIEYSSTSFMMLFLSEYCSILIM 236
52220980  160 QMNL---EHMTALTKSSPISLMMSI-TLMMRMITSLAETNRTPFDFSEGESELISGFNVEFSGKSFMFLFLAEYSSILIM 235
213948237 163 SFNL---NDFYIYQMNSKFFFFLFL-MFILLLISFLAEMNRSPFDFSEGESELVSGFNIEFSSLSFIFIFMSEYMSIMFM 238
226968607 158 EFNF-----FFYYINNNMLLFFSMM-YMIMLVMIVLSEMNRTPFDFLESETELVSGFNVEYFSSLFSFIFLVEYGFFLFM 231
301353325 158 EFNF-----FMYYMSKNLILLFSLM-YLMTFMMIVLSEMNRTPFDFLESETELVSGFNVEYFSSLFSFIFLVEYGFFLFM 231
51830061  163 SFNL---NDFYLYQINLKFFFFLFF-LFILLLISFLAEMNRSPFDFSEGESELVSGFNIEFSSLSFIFIFMPEYMSIMFM 238
171473584 239 SFLIISIFMGGFmSNMITIGLFGSFFCFSFIWIRGCFPRYRYDKLMYLAWKIYLPISLFFLFFYICLKFFC 309
49146490  236 SLITLTMFFNMK-MSSMIFFFTFMILCFLFIWTRCTLPRFRYDKLMYLTWIKFLPLTILYFFFSLSFKLYY 305
51830193  236 SMISAQMFLMFK--SNILMLISFIMFSLSFIWIRTTFVRFRYDKLMKFNWTQMLPFLMMMILFYFDYKVYC 304
51830153  237 SFITVNMMI-MT-NQKVFTLMMYMTVCVFFIWTRSTLPRFRYDKLMMFNWIQLLPMTTVLLMISFMMKMY- 304
52220941  237 SLLTTCMFTNLT-PVNPSFYVVYLVISFVFIWTRTTLPRFRYDKLMKFNWIQILPMTAMMLSISFPMKIL- 305
52220980  236 AMMTTTLFFSAA-LPSPEFVLVYLALCFTFVWTRTSLPRFRYDKLMKINWQQILPTTMTALMLSFSLKLYY 305
213948237 239 GMLLCEMFFGLL-MNKFYLNIFILMFMFLVIWLRGFLPRFRYDKLMYLIWKLILPLSLFLFVFNFSIKLFN 308
226968607 232 -MFMISFFLKLD-------MFMNLLMIMMFIWTRAFMPRYRYDKMLNLFWKDLVLMVMVFFL--------- 285
301353325 232 -MILITFFFNLN-------FMIMLSLTIMFIWTRAFMPRYRYDKMLNLFWKDLVIMVMILFL--------- 285
51830061  239 GMLLCEMFFGLM-MNKFYLNIFILIFMFLVIWLRGFLPRFRYDKLMYLVWKLILPLSLFLFMFNFSIKLFN 308
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap