Conserved Protein Domain Family
ND4L

?
MTH00192: ND4L 
NADH dehydrogenase subunit 4L; Provisional
Statistics
?
PSSM-Id: 177240
View PSSM: MTH00192
Aligned: 4 rows
Threshold Bit Score: 88.4395
Threshold Setting Gi: 124359023
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
108860655  1 MTTGYLLVSIILFTTGVSGIIINKNNIILILMSIELILLAISYLLIVYSVTLDNLLGIIFSLMVLTVAAAESAIGLAILV 80 
124358992  1 MTTGYLLVSIILFTTGVSGIIINKNNIILILMSIELILLAISFLLIVYSVTLDNLLGIIFSLMVLTVAAAESAIGLAILV 80 
124359006  1 MTTGYLLVSIILFITGVSGIIINKNNIILILMSIELILLAISYLLIVYSVTLDNLLGIIFSLMVLTVAAAESAIGLAILV 80 
124359023  1 MTTGYLLVSFILFTTGVSGIIINKNNIILILMSIELILLAISYLLIVYSVTLDNLLGIIFSLMVLTVAAAESAIGLAILI 80 
108860655 81 AYFRLTGTITIKALNLLRG 99 
124358992 81 AYYRLTGTITIKALNLLRG 99 
124359006 81 AYYRLTGTITIKALNLLRG 99 
124359023 81 AYFRLTGTITIRALNLLRG 99 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap