Conserved Protein Domain Family
CYTB

?
MTH00191: CYTB 
cytochrome b; Provisional
Statistics
?
PSSM-Id: 177239
View PSSM: MTH00191
Aligned: 50 rows
Threshold Bit Score: 531.028
Threshold Setting Gi: 270267726
Created: 9-Dec-2010
Updated: 2-Oct-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
270267452   1 MMRKNELIKLFLGSFSYLPAPVNISYLWGWGSTIGVVLIMQVITGLFLSMHYCADVNYAFDSVVH-IHRDVFFGWLVRAM 79 
157384917   1 MWRNNSFISLFMGSFYSLPSPVNLSYWWNMGSLLGLFLIIQIVTGLFLTMHYAGNIEVAFDSVSKtIGRDANYGWVLRYA 80 
157384903   1 MWRNNSLISLFMGSFFSLPSPANLSYWWNMGSLLGLFLVIQIVSGLFLTMHYASNIEVAFDSVSKtIGRDSNYGWVFRSI 80 
28436205    1 MLRNNPLINLFIGSFYRLPAPININYFWNGGSTIGVFLVIQIVSGLFLSMHYTSHMQMSFFSVNH-IMRDVNGGWLLRYM 79 
27228449    1 MLRKNPLINLFIGSFYRLPAPINISYLWNGGSLIGMFMVVQILTGLFLSMHYCGNVLMAFSSVNH-IMRDVNGGWMMRYM 79 
242543526   1 MIRNGSLVSILYGSFGRLPSPINISYMWNFGSTIGLFLVSQILTGIFLTMHYVADVSMAFDSVVH-IINEVNYGWVMRYM 79 
7335698     1 -------MGLFLDTFAKLPSPVNLSYWWNWGSMVGVLLVGQILTGLFLTMHYVSDVGYAFDSVVH-IHRDVSYGWVVRSV 72 
270267398   1 MLRKHSLVDLVLGSFYHLPSPINISYWWNWGSIVGVVLVLQIFTGLFLTMHYVGDVGKAFDSVVH-IHRDVHYGWLIRSM 79 
270267726   1 MLRKDPLVSLFYGSFVRLPSPVNISYFWNFGSCVGFFLIVQILTGLFLSMHYSPDVNLSFDSLTH-IIMDVNFGWSLRYI 79 
284177715   1 MLRKNVLMSLVLNSFSYLPAPANISYWWNWGSMIGVTLVLQILTGLFLTMHYVSSAECAFDSVVH-IHRDVMGGWAMRSM 79 
270267452  80 HMNGASLFLFCIFLHVGRGLYYKSFMNVHTWGVGVILLILSMVTSFFGYVLPWGQMSFWGATVITNFLSVIPFYGNEIVT 159
157384917  81 HANGASFFLALIYLHMGRSIYYKRYNNLHTWSVGVVLLALSMLTAFLGYVLPWGQMSFWGATVITNLITAIPVWGGSIVT 160
157384903  81 HANGASVFLALIYLHMGRGIYYKRYGNLHTWSVGVVLLALSMLTAFLGYVLPWGQMSFWGATVITNLMTAIPIWGGALVT 160
28436205   80 HANGASFFLGLIFLHIGRNVYYKTYYRKGAWIIGILLLVVSMLTAFLGYVLPWGQMSFWGATVITNLITAVPVYGEAIVK 159
27228449   80 HANGASFFLAFIFMHIGRNLYYKTYYRKGAWLVGIVLLILSMLTAFLGYVLPWGQMSFWGATVITNFVTAIPVWGEPIVN 159
242543526  80 HMNGASFFLGFIYLHIGRGIYYKRYFSVNAWLVGVVLLALSMLTAFLGYVLPWGQMSFWGATVITNMVSAVPKYGTSIVF 159
7335698    73 HANGASFFMFGLFMHVGRGLYYKSYLDFRVWYVGVILLVVSMLTSFFGYVLPWGQMSFWGATVITNLLSAIPFYGADIVY 152
270267398  80 HANGASLFLFGIFMHVGRGLYYKSYLKFHVWGVGVLMLIVGMLTAFLGYVLPWGQMSFWGATVITNLVSAVPYIGSDIVY 159
270267726  80 HMNGASMFLALIYLHTSRGLYYKRYGNFHAWSVGVLMLALSMLSAFLGYVLPWGQMSFWGATVITNMISALPVYGTNVVY 159
284177715  80 HGNGASLFMFCIYMHIGRGIYYKSFMNVHVWGVGVVLFILAMITAFLGYVLPWGQMSFWGATVITNFLSVIPVYGTDVVN 159
270267452 160 WIWGGFSVGGPTLSRFYTFHFVVPFLIIVFSLVHLLFLHRM-GSSNPLQLSSNSMKINFWPYSGIKDLVWFLFIFTLFFC 238
157384917 161 WVWGGFSVDNAALNRFYTLHFLVPFLIGVVALVHLVVLHEE-GSGNPVGSFSSSLKIFFWPYFGVKDILGVGVVLFVFLA 239
157384903 161 WVWGGFSVDNAALNRFYTLHFLVPFIIGVMALVHLVVLHEE-GSGNPLGVFSSSFKIFFWPYFGVKDILGALFVLSLFLG 239
28436205  160 WLWGGFSVENPTLNRFYTFHFLFPFVIVALSVVHLFFIHML-GSSTPLGTFSNTMKLDFWPYYGVKDIFGFSIIISSFMM 238
27228449  160 WLWGGFSVDNPTLNRFYTFHFLFPFLIIALSVVHLFFIHQT-GSSNPLGNFSDNLKLDFWPYYGVKDILGMFLALFFFLL 238
242543526 160 WLWGGFSVGAPTLTRFYTFHFLFPFLIAVFAVLHLYFIHGSgGSGNPLGPFSNSIKIPFWPYYGLKDILGFVIFYSIFLF 239
7335698   153 WVWGGYSVGAPTLTRFYTFHFIFPFLIAVLSLVHLVFLHSK-GSTNPLKATTAGFKVSFWPYFGVKDIYGFFVVFWVLYL 231
270267398 160 WLWGGFSVGGATLTRFYTFHFLFPFLLVVLSLVHLVFLHTG-GSTNPLKGSSNSLKIYFWPYSGVKDVVGFFLLGVAYMF 238
270267726 160 WLWGGYSVAGPTLSRFFTFHFIFPLIIAFLALIHLYFIHGGgGSGNPLGMFSDSYKISFWPYYGYKDILGLIFLLFFFLI 239
284177715 160 WIWGGFSVGGPTLTRFYTLHYLMPFVIVVFSLLHLVFLHSK-GSGNPLGVSSKSLKFNFWPYSLVKDYNSFLTILVFYLL 238
270267452 239 IVFFFPQVFSDPENYIKANPMVTPVHIKPEWYFLFAYAILRCIPNKTLGVLGLVMSIVVFFMLSVVNKMFNIshTKVKSF 318
157384917 240 VVFLAPDMFGDPDNFYQANPMVTPVHIKPEWYFLFAYAILRSIPNKGLGVLSLVVSILVFFLLPWGGGV-----GFTPSV 314
157384903 240 IVFLAPDMFGDPDNFYKANPMVTPVHIKPEWYFLFAYAILRCIPNKGMGVFALVLSIVVFFFLPWVGGV-----SYLPTV 314
28436205  239 LVGFSPDLFGDPENFKKANSMVTPVHIKPEWYFLFAYAILRCIPNKKLGVFGLVFSILVFFFFLFSKK------KLMSSL 312
27228449  239 LVGFSPDLFGDAENFLKANSMVTPVHIKPEWYFLFAYAILRCIPNKKLGVLALVFSIVVFFFFIFSKK------KLLPSL 312
242543526 240 VVFIYSDTFSDPDNYGKANPLVTPVHIKPEWYFLFAYAILRSIPNKLLGVISLVMSVLIFAFLPLSQQ------KFSLSI 313
7335698   232 VVGFYPDAFGDPDNFMKANPMVTPLHIKPEWYFLFAYAILRCIPNKGLGVLALVMSIVFFFFMSIFSFLFG---IKKKGV 308
270267398 239 IVLLNSNVFMDPENFMKANSLVTPTHIKPEWYFLYAYAILRCIPNKGLGVLGLVMSILTLFLLPVLAVVFNK--LSGKSF 316
270267726 240 NVFFFSDTFSDPDNYTQANPLVTPVHIKPEWYFLFAYAMLRSIPNKLLGVLSLVFSILVFFFMPLGNS------KLTCTL 313
284177715 239 VVFFFPNVFGDPENFMKANSLVTPVHIKPEWYFLFAYAILRCIPNKSMGVVALVMSVVVLLFLPMLNMVNKNfyVKGNSL 318
270267452 319 SYMVCFWIFSINFIILTWLGGSPVEDPFIFLAQVSSIVYFLCLFLMAVL 367
157384917 315 VYQVVVWLWVANFFLLTWLGGCPVKDVYTHLAQVSGFLYFALIALFVCL 363
157384903 315 AYQMVVWLWVANFFLLTWLGGCPVKDTFTHLAQVSGFLYFSLIILFVWL 363
28436205  313 FYRLIFWSWSMNFIMLTWLGGCPVKDVFIYMAQISSFIYFFFLLILMLI 361
27228449  313 SYRFVFWIWAMNFIMLTWLGGCPVKDIFIFMAQISSFIYFFFLFLMMII 361
242543526 314 WHQFIFWFWVFDFMILTWLGGCPVKSMFNFMSQVFGLLYFFSFFFFSLL 362
7335698   309 SYPMVFWVWSVNLRLLTWLGGSPVEPPYVYMAQVCGCPLFYFVIYVVYC 357
270267398 317 FFQVVFWVWSVNFLLLTWLGGAPVEDPYIVMAQVCSVVYFVSLLLLSVV 365
270267726 314 IYQILFWMWVFNFIMLTWLGGCPVKDVFNYLSQLGGIVYFLLLFFLLFT 362
284177715 319 MRKMVFWVFSFNFLVLTWLGGSPVEEPYIFLAQVSSVLYFFSIMMLGIL 367
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap